KEGG   Bacillus anthracis A0248: BAA_2939Help
Entry
BAA_2939          CDS       T00892                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4004 Phage_CI_repr HTH_28 HTH_26
Motif
Other DBs
NCBI-ProteinID: ACQ47774
Position
complement(2667227..2667850)
Genome map
AA seq 207 aa AA seqDB search
MSTDLISKKDLLELTGISYGQLYRWKRKNLIPEDWFVRKSTFTGQETFFPKEKILERINK
IQTMKEDLSLDELANMFSPSVREILLTKEDILRKGIASEPVLQFFIEQTNKTSEFQFVDI
LYVYMLEELLQSGEISLEEGKMVMQVLRENYEAIKHKTCDLIIVRKLGISTCFLVSNVDD
LIFEKGTKIVLREAITKYTEALKTKLL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttgagtacagatttaatttcaaaaaaagatttattagagctaactggtatttcatacgga
cagttatataggtggaaaagaaaaaatttaataccggaagattggtttgtacgaaagtca
acattcactggtcaagagacattttttccgaaagaaaagatattagaacgtattaataaa
attcaaacgatgaaagaagatttatcacttgatgaactagcgaatatgttttcaccgagt
gtaagagaaattcttttaacaaaagaagatatcttacgtaaagggattgcatcagaacca
gttttacaatttttcatagaacaaacgaataaaacatcagagtttcaatttgtagatatt
ctttacgtgtacatgttagaagaattattacaatcgggagagattagtttagaagaagga
aaaatggtcatgcaagttttacgtgaaaattatgaagcaattaaacataaaacttgtgat
ttaattatcgttcgtaagttagggatttctacatgtttcttagtttcaaatgtggatgat
ttaatttttgaaaagggaacaaaaatcgttttacgtgaagcaattacgaaatataccgaa
gcattaaaaacgaaactattgtag

DBGET integrated database retrieval system