KEGG   Bacillus anthracis A0248: BAA_2941Help
Entry
BAA_2941          CDS       T00892                                 

Definition
(GenBank) major facilitator family transporter
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 MFS_1_like Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ACQ50008
Position
2669849..2671087
Genome map
AA seq 412 aa AA seqDB search
MNHLLLRYNKPIIIRLGGELLTRTTESMLALIMIIYVNKMLNGNIMITMLIFGLQPFSDI
VFTLIAGGITDKYGRKKIMLLGLLLQGVAIGSFVFAQSVFIFALLYVINGIGRSLYIPAQ
RAQIADLIKQGQQAEIFALLQTMGAIGTVIGPLIGAVFYNTHPEYLFIMQSITLMVYAVV
VWTQLPETAPAITMPKQKLEVSSPKQFVRNHSAVIGLMVSTLPISFFYAQTETNYRIFAE
DVFPNFIFILAFISTCRAIMEIILQIFLVKWSERFSMAKIIIISYTCYIVAAIGYGFSAT
IVSLFFTLLFLVIGESIALNHLLRFVSEIAPSDKRGLYFSIYGLHWDVSRTCGPVIGAIL
LSKLNGSMLFYICACFLTIGGIIQALFVRNLERKKRREVIQKDVLEHPHHIL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcatctcttattacgttacaataaaccaatcattattagactgggcggtgaatta
ttaactcgaacaacagaatccatgttagcactcattatgattatttatgttaataaaatg
ttaaacggtaatataatgattactatgcttattttcgggctacaaccattttcagacatc
gtatttacactaattgctggtggaattactgataaatatggacgaaagaaaatcatgtta
ctaggattgttactacaaggtgttgcaatcggtagtttcgttttcgctcaatccgttttt
atatttgcattgttatacgtcataaatggtattggccgttccttatatattcccgctcaa
cgggcacaaattgctgatttaataaaacaagggcagcaagcggaaatttttgccctcctg
caaacgatgggagcaattggtaccgtaattggccctttaattggtgcagtcttttataac
actcatcctgaatatttatttataatgcaaagtattacacttatggtttatgcagtagtt
gtttggactcagctcccagaaaccgctccggcaattacaatgcccaagcaaaaacttgaa
gtatcatctccaaaacagtttgtacgcaatcattccgccgtaattggacttatggtttct
acactgcctattagctttttttatgcacaaactgagacaaattatcgtattttcgcagaa
gatgtatttccgaatttcattttcatactcgcttttatttcaacatgccgggctattatg
gaaatcattctacaaattttcctcgtaaagtggtctgaaagattttccatggccaaaatc
atcattatttcttatacctgttatatagtagctgcaattggctacggcttttcagcaaca
atcgtgtcactatttttcacattactctttttagtcattggcgaaagtattgctttaaac
catttacttcgatttgtttcagaaatcgctccttcagataaacgtggattgtatttttca
atttacggcttacactgggatgtatctcgaacgtgcggtcctgttatcggtgcgatttta
ttaagtaaactaaacggtagtatgctattttatatttgtgcttgtttcttaacaattgga
ggcattatccaagctctttttgttcgaaatttagagcgtaagaaaagaagagaagttatt
caaaaagatgttttagagcatccccatcatattttataa

DBGET integrated database retrieval system