KEGG   Bacillus anthracis A0248: BAA_2942Help
Entry
BAA_2942          CDS       T00892                                 

Definition
(GenBank) putative lipoprotein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4309 DUF3393 SID-1_RNA_chan
Motif
Other DBs
NCBI-ProteinID: ACQ49140
Position
complement(2671171..2671815)
Genome map
AA seq 214 aa AA seqDB search
MKVYVKIALLCLTFTCIFALAACKGTDEKKETNPTSENSKNEQNTSSEGKKEPEVKSNTD
SNSKDIVINQKSINHVKNLFELAKEGKVPNVPFAAHTGDIEEIEKAWGKADKTEQAGNGM
YATFTNKNVSFGFNKGSQVFDVRSYHAELKSITLQEIEKALGKPNSVKGNGEDKIYVYKV
NKQFELKFIIPKSTGKVNHISVFSPEDSINKMAG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtatgtaaagatagctttattatgtcttacttttacatgcatatttgcctta
gcggcatgtaaaggaacagatgaaaaaaaggaaacaaacccaacttcggaaaatagtaaa
aacgaacagaatacttcttctgaaggaaagaaagagcctgaggttaaatcaaataccgat
tcaaattcgaaggatatagttataaaccaaaaatcaattaaccacgttaaaaacttgttt
gaactagcgaaagaaggaaaagtacctaatgttccgttcgcagctcatacaggagatatt
gaagaaatagaaaaagcgtggggaaaagcagataaaacagaacaagcaggaaacggaatg
tacgcaacttttacaaataaaaatgtttccttcggttttaataaaggatcacaagttttt
gatgtacgctcctatcatgcagaactaaaatcaattacattacaagaaattgaaaaggca
ttaggaaaaccaaactcagttaaaggaaatggtgaggataaaatatatgtatataaagta
aacaagcagtttgagttaaaattcatcattccaaaatcgactggaaaggtaaatcatatt
tcggtattttcgccagaggatagtataaacaaaatggcagggtag

DBGET integrated database retrieval system