KEGG   Bacillus anthracis A0248: BAA_2948Help
Entry
BAA_2948          CDS       T00892                                 

Definition
(GenBank) hypothetical protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3970
Motif
Other DBs
NCBI-ProteinID: ACQ50505
Position
complement(2674840..2675028)
Genome map
AA seq 62 aa AA seqDB search
MIRVRIEGTEEEMLEFMEKMPDIPGFEKTHMREPRKGNNPKYDSSKNVLAYLSYKKIEVA
NK
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgtacgtattgaaggaactgaagaagaaatgcttgaatttatggagaaaatg
ccggatattcctggatttgaaaaaacacatatgagagaaccgagaaaaggaaataatcca
aaatatgattcaagtaaaaatgtactagcatatttatcttataaaaagattgaagtcgcc
aataaatag

DBGET integrated database retrieval system