KEGG   Bacillus anthracis A0248: BAA_2953Help
Entry
BAA_2953          CDS       T00892                                 

Definition
(GenBank) putative transporter
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 MFS_2
Motif
Other DBs
NCBI-ProteinID: ACQ48597
Position
2677949..2679151
Genome map
AA seq 400 aa AA seqDB search
MWRNKNVWIVLIGEFIAGLGLWLGILGNLEFMQKYVPSDFMKSVILFIGLLAGVLVGPMA
GRIIDQYEKKKVHLYAGFGRVISVIFMFFAIQFESIAFMIAFMVALQISAAFYFPALQSV
IPLIVREHELLQMNGVHMNVGTIARIAGTSLGGILLVVMSLQYMYAFSMAAYALLFLSTF
FLQFEDKKSTTPSKQAAKDNSFMEVFRILRGIPIAFTALILSIIPLLFIAGFNLMVINIS
EMQHDPTIKGFIYTIEGIAFMLGAFVIKRLSDHFKPEKLLYFFAVCTAFAHLSLFFSDIK
WMSLTSFGLFGFSVGCFFPIMSTIFQTKVEKSYHGRLFSFRNMFERVMFQIVLLGTGFFL
DTIGLQYMVLIFGVISLFIIFISLSKQKQYEKQPSQSANL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtaataaaaatgtttggattgttttaattggggagtttattgctggtttaggg
ttatggcttggaattcttggcaacctggaatttatgcaaaaatatgtcccttctgatttc
atgaaatcagttatattgtttatcggactattagcaggtgttctagtgggacctatggct
ggtcgtatcatcgatcaatatgaaaagaaaaaagtccatctttatgctggttttggtcgt
gttattagtgttatttttatgtttttcgctatccaatttgaaagtatcgcctttatgatt
gcatttatggttgcacttcaaatttcagcagcattttatttccctgcattacaatctgta
attccactcatcgtacgtgagcatgagttattacaaatgaacggtgtacatatgaatgta
ggtacaatcgctcgtattgcaggtacttcactaggtggaattcttttagttgtaatgagt
ttacaatatatgtacgccttctcaatggcagcatatgctttattattcctctcaactttc
ttcctacaattcgaagataagaaatcaacaacaccaagtaaacaagctgcaaaagataat
agctttatggaagtatttcgtattttaagaggaattccgattgctttcacagcacttata
ttaagtattatccctctattatttatagctggatttaatttaatggtaattaatattagc
gaaatgcaacatgatccaacgattaaaggctttatatatacgattgaaggtatcgcattt
atgttaggcgccttcgttattaaacgtttatctgatcatttcaaacctgaaaagttacta
tatttcttcgctgtttgtaccgcttttgcacatctatcattgttctttagcgatataaaa
tggatgtctcttacatcatttggattgtttggttttagtgttggttgtttcttccctatt
atgtcgacaattttccaaacgaaagtggaaaagagctatcacggccgactcttctcattc
cgtaatatgtttgaaagagtgatgttccaaattgtcttacttggcacaggcttcttctta
gatacgattggattgcaatatatggttcttattttcggtgttatttcattattcattatt
ttcatatcgctttctaaacagaaacagtacgaaaaacaaccatcgcaatctgcgaattta
taa

DBGET integrated database retrieval system