KEGG   Bacillus anthracis A0248: BAA_2956Help
Entry
BAA_2956          CDS       T00892                                 

Definition
(GenBank) putative (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00061  Fatty acid biosynthesis
bai00780  Biotin metabolism
bai01100  Metabolic pathways
bai01212  Fatty acid metabolism
Module
bai_M00083  Fatty acid biosynthesis, elongation
bai_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BAA_2956
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAA_2956
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bai01004]
    BAA_2956
Enzymes [BR:bai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BAA_2956
Lipid biosynthesis proteins [BR:bai01004]
 Fatty acid synthase
  Component type
   BAA_2956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: ACQ50184
Position
2681573..2681971
Genome map
AA seq 132 aa AA seqDB search
MHIKDTLPHRYPFLMIDKVKNVKQGESVTGYKLITNNEWFINDSQNHMPHMLIVEALAQL
SAFVHTSESDGLGFLSSLDGVTFHEKAYPGDKLDLHYELTRNRRGFVLGKGTATVNNQPI
VTIEKLLIYQTE
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcatattaaagacacgcttccccatcgttatccatttttaatgattgataaagtaaaa
aacgtaaaacaaggtgaatccgttacaggatataaactcattacaaataacgaatggttt
ataaatgatagtcaaaatcatatgcctcatatgttaattgtagaggcacttgctcagctt
agtgcatttgtacatacaagtgaatctgacggactaggcttcctttcctcgttagatggg
gttacgttccatgaaaaagcatatcccggtgataaacttgatttacattatgagttaact
cgcaatcgccgaggttttgttctcggtaaaggtaccgcaactgttaataatcaaccgatt
gtaacgatagaaaagctattaatataccaaacagaatag

DBGET integrated database retrieval system