KEGG   Bacillus anthracis A0248: BAA_2967Help
Entry
BAA_2967          CDS       T00892                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_small_YrzI
Motif
Other DBs
NCBI-ProteinID: ACQ48467
Position
2687257..2687400
Genome map
AA seq 47 aa AA seqDB search
MTFHIFFFTTVLQKNTLTEAEINRKQQLKQLTDKMTDIKSSYYTQMY
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcatattttcttttttacgactgtacttcagaaaaatactttaactgaagct
gaaatcaatcgtaaacaacaattaaaacaactgactgataaaatgactgacattaaaagt
tcatactatacgcaaatgtattaa

DBGET integrated database retrieval system