KEGG   Bacillus anthracis A0248: BAA_2971Help
Entry
BAA_2971          CDS       T00892                                 

Definition
(GenBank) putative membrane protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport YwiC Phage_holin_3_3 m04gp34like
Motif
Other DBs
NCBI-ProteinID: ACQ46299
Position
complement(2688316..2689401)
Genome map
AA seq 361 aa AA seqDB search
MKSKVHFWTLEVLMVVAIIFICTKISFLFQPIGIFISTLFFPILIALFLYFIFNPVLVFL
EDKKVPRNLAILLLYLFIITLTAVGVGVVVPTISQQLMDLVKNMPGYIKEGKVYIQDLSH
HRLFEWLSTQNYVSIETIEKNAIEYLKDIPNTLTSSATALFGIITNVALVIFTVPFILFY
MFKDGHAFPGKAVSLLPESYREEGLRIIKETNETLSAYIQGQALVCIFVGAFTFIGYFII
DLPYAFVLGIIAAFTNIIPNLGPFIGAAPAVIVGLFVSPMQALYVIIIVTIVQQFESNII
SPRIMSSKLNIHPLTIIILILGVGNFAGIIGMILAVPVYAVTKTVVSNLVRLFKTKRSNR
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcgaaagtgcacttttggacattagaagtgctaatggttgtagcgatcatattt
atttgcacaaaaatatcgtttctatttcaaccgattggtatcttcatatcaacgttgttt
ttcccaatcttaatcgcgctttttttatacttcatatttaatccggtgttagtctttttg
gaggataaaaaagtacctagaaatttagcgattttactgttatatctttttatcataaca
ttaactgcggttggagttggagtagtagttccaacgatctcccaacagctaatggattta
gtaaaaaatatgccaggttatataaaagagggaaaagtatacatacaagatttatcccat
catagattgtttgaatggttatctacacaaaactatgtttccattgaaacaattgaaaaa
aatgcaattgaatacttaaaggatataccaaacacacttacgtcgagtgcaacggcttta
tttggtattatcacgaacgttgcgttagtcatatttacagtaccgttcatattgttttac
atgtttaaagatggacatgccttcccaggtaaagcagtaagcctattaccggagtcttac
cgtgaagaaggacttcgcatcattaaggaaacgaacgaaacattgtctgcttatattcaa
ggacaagcactcgtttgtatatttgtaggtgcttttacttttatcggttatttcattatc
gatttaccgtacgcttttgttttaggaattatagcagcatttactaatatcattcctaac
ttaggtccatttatcggtgcagcaccagctgttatcgtaggtctgttcgtatctccgatg
caagcgttatacgtaattattatcgtaacaattgtacaacagtttgaaagtaacatcatt
tcaccgcgtattatgagttcaaaattaaatatccatccgttaacaattattattttaatt
ttaggggtaggtaactttgcgggaattatcggaatgattttggcggtaccagtttatgca
gtaacgaaaacagttgtatcgaacttagtgagactgtttaagacgaaacgaagtaatcga
aaatag

DBGET integrated database retrieval system