KEGG   Bacillus anthracis A0248: BAA_2978Help
Entry
BAA_2978          CDS       T00892                                 

Definition
(GenBank) transcriptional regulator, TetR family
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N DUF4373
Motif
Other DBs
NCBI-ProteinID: ACQ48332
Position
complement(2695603..2696193)
Genome map
AA seq 196 aa AA seqDB search
MKRISKEPDVRRQELMDIGFELYMKNGMKGFGIKDVVNHAGVATGLFYYYFKSKENFVDE
VLNDFIVKNMELIEEILISNERSVMQKLKDSLNIFWTFIEKLAPYKNLSSFQTEQHFQLE
QKLFTRMQPLIRQVIEEGVKTGIFNTDNSLLTSGFILYGLSSIAHSEVNLNLDTKQEMIN
LVLNTLRYDQSEGECI
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatatcaaaagaaccagatgttagaaggcaagagttgatggatattggtttt
gaactatatatgaaaaatggtatgaaaggatttggcataaaagatgttgtgaatcatgca
ggtgtagcaacgggcttattttattattacttcaagtctaaagagaattttgttgatgaa
gtattaaatgattttattgtgaaaaatatggagttaattgaagaaatacttatttctaat
gaacggtctgtcatgcaaaagctgaaagattctctaaatatattttggacatttatcgaa
aaattagcaccttataaaaatttgagttcgtttcagacggaacaacattttcaactggaa
cagaaattatttacgcgaatgcagccattaattcgacaagtaatcgaagaaggggtgaaa
actgggatttttaatactgataactcattattaacatcaggatttattttatacggtctt
agcagtattgctcattcagaggtgaatttgaatctagacacgaagcaagaaatgattaat
ttagtattaaatacactacgatacgatcaaagtgaaggagaatgtatatga

DBGET integrated database retrieval system