KEGG   Bacillus anthracis A0248: BAA_2979Help
Entry
BAA_2979          CDS       T00892                                 

Definition
(GenBank) conserved domain protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF402
Motif
Other DBs
NCBI-ProteinID: ACQ49296
Position
complement(2696403..2696912)
Genome map
AA seq 169 aa AA seqDB search
MNKLLTLKSKIVERKIRYDSTIVDHTCLLLEKQLQSIVLFHEVQYSFTMTAHRASLTIPK
GSYTIAYYWEDRPYNLYIWRDKNGMYVGSYFNVVKNTQITDELVSFEDLIIDILVLPSGE
YFILDEDELPEPLDGFEGGYVNEALNVLEEIIQKMLPQMIVETEMVWLN
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattactaacacttaaaagtaaaattgtagaaagaaaaatccgatatgactcg
acaatagtagatcatacttgcttattacttgaaaagcagttgcaaagtatcgtgctattt
catgaggttcagtattcatttacaatgactgcacatcgtgcgagtttaacaatcccaaaa
ggaagttacaccattgcatactattgggaagatcgtccgtacaatttatacatatggaga
gataaaaatggaatgtatgtaggctcttattttaatgttgtaaaaaatacgcaaataaca
gacgaactagtgtcatttgaagatttaattattgatattttagtacttccaagcggagaa
tattttattttagatgaggatgagttacctgagcctttagatggttttgagggcggctat
gtgaatgaagctcttaatgtattagaggaaatcattcaaaagatgcttcctcaaatgatt
gtagagacagaaatggtatggttaaactaa

DBGET integrated database retrieval system