KEGG   Bacillus anthracis A0248: BAA_2980Help
Entry
BAA_2980          CDS       T00892                                 

Definition
(GenBank) MutT/NUDIX family protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ACQ48523
Position
complement(2697016..2697510)
Genome map
AA seq 164 aa AA seqDB search
MNNATNFHRAFGVYGICIENNHILVIDKMKGPYRNRYDLPGGSLEDGEALLAGLHREIKE
ETGLNVTVVKQIGTIDFQFPSKFKEYTHVHHIAVFYGVERCGGEFEVPEQFEEQDSSGAR
WIPIESITERNSSPLVCSAVEWLKSNELPLEVKKYETWTVKNSF
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatgctactaattttcatcgtgcgtttggtgtgtacggcatttgtatcgaaaac
aatcacatattagtaatcgataaaatgaaaggtccatatagaaatcggtatgatctacct
ggtggtagtctagaagatggagaagcattattagctggacttcatagagagataaaagag
gagaccgggctaaatgtaacggtagtaaaacaaataggtacaattgattttcaatttcca
tcaaagttcaaggagtacacacatgtacatcatatcgcagttttctacggtgttgaaagg
tgcggaggtgaattcgaagtaccggaacaatttgaagaacaagattcatcaggagctaga
tggattcctatcgaaagcattacagaacgcaattcatctccgcttgtatgtagtgcagta
gagtggctgaaatcaaatgagcttccattagaagtgaaaaaatatgaaacatggacagtg
aaaaactccttctaa

DBGET integrated database retrieval system