KEGG   Bacillus anthracis A0248: BAA_2983Help
Entry
BAA_2983          CDS       T00892                                 

Definition
(GenBank) putative flavoprotein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Epimerase NAD_binding_10 adh_short
Motif
Other DBs
NCBI-ProteinID: ACQ49822
Position
complement(2699162..2699851)
Genome map
AA seq 229 aa AA seqDB search
MKGKKVLITSGGCLEKWDQVRGHTNMAKGTIGRIIAEELISKGAHVIYLHGYFAEKPNDI
NNQLELHPFEGIIDLRDKMKSIITHEKVDAVIMAAAGSDWVVDKICDQEGNVLDMNGKIS
SDIAPIIHFQKAPKVLKQIKQWDSETVLVGFKLESDVNEEELFERAKNRMEEAKASVMIA
NSPHSLYSRGAMHYVIGQDGKGQLCNGKDETAKEIVKRLEVLCNHVTAL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggaaaaaggtattaattacaagcggtggttgtttagaaaagtgggatcaagta
cgcggacatacaaatatggcaaaaggaacaattggaagaataatcgccgaagagcttata
agtaaaggggcccatgttatatatttacacggttattttgcggagaaaccgaatgatata
aacaatcaattagaattacacccatttgaaggaattattgatttacgagataaaatgaaa
agtatcattacgcatgaaaaagtcgatgcggttattatggcagcggctgggtctgattgg
gttgtggacaaaatttgtgatcaagagggcaatgttcttgatatgaatggaaaaatctca
agtgatatagcgccaattatacattttcaaaaggcaccgaaagtattaaaacaaataaaa
cagtgggattcagaaactgtactcgttggctttaaacttgaaagtgatgtaaatgaagaa
gaactgtttgaaagagcgaaaaatagaatggaagaagcgaaggcaagtgtaatgattgca
aattcaccacattctttatattcgcgcggagcaatgcactacgtaattggacaagacggt
aaagggcagttatgtaatggaaaagatgaaacagcgaaagaaattgtcaaaaggttagaa
gtactatgtaatcacgttactgctttataa

DBGET integrated database retrieval system