KEGG   Bacillus anthracis A0248: BAA_2984Help
Entry
BAA_2984          CDS       T00892                                 

Gene name
aacC7
Definition
(GenBank) aminoglycoside N3-acetyltransferase
  KO
K00662  aminoglycoside 3-N-acetyltransferase [EC:2.3.1.81]
Organism
bai  Bacillus anthracis A0248
Brite
KEGG Orthology (KO) [BR:bai00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bai01504]
    BAA_2984 (aacC7)
Enzymes [BR:bai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.81  aminoglycoside 3-N-acetyltransferase
     BAA_2984 (aacC7)
Antimicrobial resistance genes [BR:bai01504]
 Gene variants
  Aminoglycoside resistance genes
   N-Acetyltransferases
    BAA_2984 (aacC7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Antibiotic_NAT
Motif
Other DBs
NCBI-ProteinID: ACQ47043
Structure
PDB: 

Position
complement(2699867..2700670)
Genome map
AA seq 267 aa AA seqDB search
MKMNDIVASTQLPNTIKTITNDLRKLGLKKGMTVIVHSSLSSIGWISGGAVAVVEALMEV
ITEEGTIIMPTQSSDLSDPKHWSRPPVPEEWWQIIRDNVPAFEPHITPTRAMGKVVECFR
TYPNVVRSNHPLGSFAAWGRHAEEITVNQSLSMSLGEESPLRKIYDLDGYILLIGVGYDS
NTSVHLSEVRSGACELIKVGAPIIENGERVWKEFVDMDYDSDKFVEIGVEFEQKGTVTMG
KIGNAKCRLMKQRDIVDFGTEWFRKKN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgaatgacatagtggcaagtacgcaattgccaaatacaatcaaaacaattaca
aatgatttaaggaaattagggttaaaaaaaggaatgacagttattgtacattcttcgtta
agttccattggctggatatcaggcggagcagttgcagtagtagaggcgttaatggaggtt
attacagaagagggaacgattattatgccaactcagtcttcggatttatctgatccgaaa
cattggtcaagaccacctgtacctgaagaatggtggcaaattatccgggataacgttcca
gcgtttgagccacatataacaccaacaagggcaatgggaaaagtagttgaatgttttcgt
acatatccgaatgtagtacgtagtaaccatccattaggaagctttgctgcatggggaaga
catgcagaagaaataacggtaaatcagtcactatcgatgagtttaggagaagaatctcca
ttaagaaaaatatacgatctagacggatacatattattaattggtgttggatatgattcc
aatacttctgtacatttatcagaagtacgttctggtgcatgtgagttaataaaagtaggg
gcacctattatagaaaatggtgaaagagtatggaaagaatttgttgatatggattacgat
tctgataaatttgtagaaattggtgtagagtttgagcaaaagggaaccgtaacaatgggg
aaaataggaaacgcaaagtgccgtcttatgaaacaacgtgatatagttgactttggaaca
gaatggtttcgtaagaaaaattag

DBGET integrated database retrieval system