KEGG   Bacillus anthracis A0248: BAA_3000Help
Entry
BAA_3000          CDS       T00892                                 

Definition
(GenBank) arylsulfatase
  KO
K19005  lipoteichoic acid synthase [EC:2.7.8.20]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00561  Glycerolipid metabolism
bai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BAA_3000
Enzymes [BR:bai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.20  phosphatidylglycerol---membrane-oligosaccharide glycerophosphotransferase
     BAA_3000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase DUF229
Motif
Other DBs
NCBI-ProteinID: ACQ46377
Position
complement(2711158..2713131)
Genome map
AA seq 657 aa AA seqDB search
MKQFLLKSKSVLSNHFGFFLFAVILFWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAV
LFLGLALFAKGKRSYIWLIVINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGS
IVALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKYKVSLVFVAGILLFSVNLGLAES
DRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYAS
PNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTG
QGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRD
DIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLETLKQPFYTKFITLSNHF
PYPIDKEEATIEPANTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHY
GISDNHNAAMSKVMGKEINSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLL
GTDTKNYVQFGSDLLSPDHKQVVAFRNGNFVSPTVTALNGKYYDTTTGKPVEFTDEIKQN
EQMVQNSLKYSDQVVNGDLLRFYTPEGFTPIDRSKYNYNNRDKNKTKVKTAPEGEAK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattcttattaaagagcaaaagtgtgctaagcaatcattttggattctttctg
tttgccgttattttattttggctcaaaacatatgcggcttatgtaacagaatttaattta
ggtatttcaaatacaattcaaaaattcttgctgtttttcaacccgcttagttcagcagtg
ttatttttaggacttgcattatttgcaaaagggaaacgatcttatatttggttaattgtt
atcaacttgttattgtcgattcttttatatgcaaacgtcgtatactatcgctttttcagt
gactttattacgttcccgacgttgacacaaacgaataactttggagatttaggtggtagt
attgttgcgttgctacatctttatgatccgctatacttcttagatacaattattttaatt
gtgttagttgcaacgaaatttgcaaatccaaaaccaattcgtgttgcgaaatataaagta
tcactagtatttgtagcaggtattttattattcagtgttaacttaggacttgcagaatct
gaccgtcctgaattattaacaagaacgtttgatcgtaattatattgtgaaatatttaggg
gcatataactatacgatttatgatggtattcaaagtgcgaaagcatcaacggaaagagcg
ttagctgatggagataatatgacggaagtaagaaattatttaacatcaacttacgcaagt
ccaaatcctgagtatttcggtaaaggtaagggaatgaacgtaatttatattcatttagag
tcattccaaaacttcttaattgattataaattaaacggtcaagaagttacgccgttctta
aactcatttacaaaagatgcgaatacgctttactttgataacttcttccatcaaacagga
caagggaaaacgtctgatgcggagtttatgttagagaattctatgtttggtttaccacaa
ggatctgtatttacaacgaaatctcataacacgtatcaatcagcaccagcaattttagga
caacaaggatacacatcagctgtattccatggtaactataaaacattttggaaccgtgat
gatatttataaatcatttggttttaataaattctttgatgcttcatactatgatatgaac
gaaaaagatgtagtaaactatggattaaaagataaaccattctttaatgaatccattccg
ttattagaaacattgaaacaaccgttctatacgaagtttattacgttatcgaatcacttc
ccgtatccaattgataaagaggaagcgacaattgaaccagcgaacacaggtgactcatct
gtagatacgtatttccaaacagcacgttatttagacgaatctgtaaaaggtttcatcgat
tacttgaagcaatctggtttatatgataattctattatcgttatgtacggagaccattac
ggtatttcagataatcataacgcagcaatgtcaaaagtaatgggtaaagaaattaactcg
tttgaaaatgcacagttacagcgtgtacctttaatcgttcgtgtaccaggtgtgaaaggt
ggcgtacaacatcaatacggtggtgaaattgatgttcttccaactcttttacacttacta
ggaacagatacaaaaaattatgttcaatttggttcagatttattatcaccagatcataaa
caagttgttgcgttccgtaacggcaacttcgtaagcccaacagttactgcactaaacggc
aaatattatgatacaacaactggaaaacctgtagaatttacagatgaaataaaacaaaat
gaacaaatggttcaaaactcgttaaaatactctgaccaagtcgtaaatggtgacttatta
cgattctacacaccggaaggatttacaccgatagatcgttcgaagtataactataacaat
cgtgataaaaacaaaacgaaagtaaaaacggctccggaaggggaagctaaataa

DBGET integrated database retrieval system