KEGG   Bacillus anthracis A0248: BAA_3245Help
Entry
BAA_3245          CDS       T00892                                 

Gene name
arsC
Definition
(GenBank) arsenate reductase (thioredoxin)
  KO
K03741  arsenate reductase [EC:1.20.4.1]
Organism
bai  Bacillus anthracis A0248
Brite
KEGG Orthology (KO) [BR:bai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BAA_3245 (arsC)
Enzymes [BR:bai01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     BAA_3245 (arsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LMWPc
Motif
Other DBs
NCBI-ProteinID: ACQ47058
UniProt: C3P101
Position
complement(2942926..2943330)
Genome map
AA seq 134 aa AA seqDB search
MENKKTIYFLCTGNSCRSQMAEAWGKQYLGDKWNVYSAGIEAHGVNPNAIKAMNEVNIDI
TNQTSDIIDANILNRADLVVTLCSHADAVCPSTPPHVNRVHWGFDDPAGKEWPEFQRVRD
EIGERIKRFSETGE
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaaaagacaatctatttcttatgtacgggaaattcatgccgaagccaaatg
gcagaagcatggggcaaacaatatttgggagataagtggaatgtgtattctgcaggaatc
gaagcacatggagtaaatccaaacgcaattaaagcaatgaacgaagtaaatatcgacata
acgaatcaaacatcagatataattgatgcaaacattttaaatcgtgctgatttagtcgtt
acgctttgtagtcatgcagatgctgtatgtccatctactccgccgcatgtgaatcgtgtt
cactggggatttgatgatccagcaggcaaagaatggcctgaatttcaacgtgtgcgtgat
gaaattggtgaacgtataaagcgattttctgaaacaggggaataa

DBGET integrated database retrieval system