KEGG   Bacillus anthracis A0248: BAA_3426Help
Entry
BAA_3426          CDS       T00892                                 

Definition
(GenBank) hydrolase, haloacid dehalogenase-like family
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00361  Chlorocyclohexane and chlorobenzene degradation
bai00625  Chloroalkane and chloroalkene degradation
bai01100  Metabolic pathways
bai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bai00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAA_3426
   00361 Chlorocyclohexane and chlorobenzene degradation
    BAA_3426
Enzymes [BR:bai01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BAA_3426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: ACQ47257
Position
complement(3119705..3120415)
Genome map
AA seq 236 aa AA seqDB search
MKYKVILFDVDDTLLDFPETEKHALHNAFVQFGMPTGYTDYLASYKEISNGLWRDLENKM
ITLSELAVDRFRQLFALHNIEVDAQQFSDVYLKNLGKEVHLIEGAVQLCEKLQDCKLGII
TNGYTKVQQSRIGNSPLRNFFEHIIISEEVGHQKPAREIFDYAFEKFGITDKSSVLMVGD
SLTSDMRGGEDYGIDTCWYNPSLKENKASVKPTYEVESLLQILELVEVAEEKVVSF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaagttatattattcgacgtagacgatacattattagatttccctgaaacg
gaaaaacacgcattacataatgcgtttgtacagttcggtatgcctacagggtatactgat
tatcttgcaagttataaagagattagtaatgggttatggagagatttagaaaataaaatg
attacgctaagtgaattagcggtagatcgatttagacaattgtttgcactgcataatata
gaagtagatgcgcagcaatttagtgatgtatatcttaaaaacttagggaaagaagtacat
cttatagaaggtgcagtgcaattatgtgagaagctacaagattgcaagctaggtatcatt
acgaatggatatacgaaggtgcaacaatctagaattggaaattcgcctttacgtaatttc
tttgaacatattattatttctgaagaggttggccatcaaaaaccagcacgtgagattttt
gattatgcgtttgaaaagtttggaattacggataaatcaagtgtactaatggttggagat
tcgctcacttctgatatgagaggcggagaagattacggcattgatacgtgttggtataat
ccgagtttgaaagagaataaggcaagtgttaagccgacttatgaagtggagagtctgctg
caaattttagaacttgtagaagtggcggaagaaaaggtagtatcattttaa

DBGET integrated database retrieval system