KEGG   Bacillus anthracis A0248: BAA_3467Help
Entry
BAA_3467          CDS       T00892                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00030  Pentose phosphate pathway
bai00480  Glutathione metabolism
bai01100  Metabolic pathways
bai01110  Biosynthesis of secondary metabolites
bai01120  Microbial metabolism in diverse environments
bai01130  Biosynthesis of antibiotics
bai01200  Carbon metabolism
Module
bai_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bai_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAA_3467 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAA_3467 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bai04147]
    BAA_3467 (zwf)
Enzymes [BR:bai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BAA_3467 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BAA_3467 (zwf)
Exosome [BR:bai04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BAA_3467 (zwf)
  Exosomal proteins of colorectal cancer cells
   BAA_3467 (zwf)
  Exosomal proteins of bladder cancer cells
   BAA_3467 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ACQ48963
Position
complement(3156119..3157603)
Genome map
AA seq 494 aa AA seqDB search
MESMTFVLFGATGDLAKRKIYPALYNLYRDQKLPKQISVIGLGRREVSHVDFQKRIKESI
ETFSRHREEGTPELEGFLDNFRYCPLDVSKPEDYERLLQVVREREEELHIKGNRMFYLSG
APEFFETIALNIKESGLDKTDGWKRLMIEKPFGHDLTSARELNDKLSRTFEEDEIYRIDH
YLGKPMIQNLEALEFANPVLQSIWNKEHIANVQITASETVGVEERAGYYDQAGAIRDMVQ
NHMLQILMMTAMNLPEKVNACEIREEKRKVMEALRKVKKEDVQNHIIRGQYGAGEINGGQ
VVAYKEEPGVNPSSNIDTFIAARLWIDNPFWTGVPFYIRTGKRMKEKSTRIVIEFKNTLK
QQYQDSNPNAAPNLLIIEISPGENVSLQLNSKNPLKNGEIEPIRINFTCEQADVGVPEAY
ERLIHDAVSGDATFFAHWREVELSWEWVQPILEAFEENLLPLHEYESGSYGPEASNELLQ
ESGFKWWLDQETKK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttggaatcaatgacctttgttttatttggagcgacaggggacttagcgaaacgcaaaatt
taccccgcactatataacttatatagagatcaaaagcttccaaagcaaatatccgttatc
gggcttgggagacgtgaagtatctcatgtagattttcaaaaaagaataaaagaatcaata
gagacgttttctcgtcatagagaagaaggtactccagaactcgaaggttttttagataat
tttcgctattgtccattagatgtgagtaagccggaagactatgagagattattacaagtc
gttcgtgaaagggaagaagagctacatataaaagggaatagaatgttctatctttccggt
gctcctgaattttttgagacaatcgctttaaatattaaggaaagcggacttgataaaacg
gatggatggaaacgcctaatgattgagaaaccgttcgggcacgaccttacatctgctcgt
gagctgaatgataagcttagtcgcacgtttgaagaagacgagatataccgtattgatcat
tatttaggtaagccgatgattcaaaaccttgaagcactagagtttgcaaatcctgtttta
caatcgatttggaataaagaacatatagcgaatgtacaaatcacagcgagtgaaacagtt
ggtgttgaagaaagggcaggatattatgatcaggcaggagccattcgagatatggttcaa
aatcatatgttacaaatattaatgatgactgctatgaatttgccggaaaaggttaatgca
tgtgaaattcgagaggaaaagcgaaaggtaatggaggcgcttcgtaaagtgaaaaaagaa
gacgttcaaaaccatatcattcgcggacaatatggtgcaggtgagataaatggcgggcaa
gttgtagcatataaagaggagccaggagtaaatccctcttctaatatagacacatttatt
gctgctcgcttgtggatcgataatccattttggactggcgttcccttttatatacgaaca
ggcaaacgaatgaaagaaaagtctactcgtattgtaatcgaatttaaaaatacgttaaaa
cagcaatatcaagatagtaatccaaatgcagcacctaacttgttaataattgaaattagc
ccaggtgagaacgtttcattacagttaaatagtaaaaatccattgaaaaatggagaaatt
gaaccgatccgtattaactttacttgtgagcaagcggatgtgggagtacctgaagcgtat
gaaagactcattcatgatgctgtgagtggagacgctacattctttgcacattggagagaa
gttgaattgtcatgggaatgggtacaaccaattcttgaagcattcgaggaaaacttatta
ccacttcatgaatatgagtctggttcatatggtccagaggcatctaatgaattattgcaa
gaaagtggatttaaatggtggttagatcaagaaacgaaaaaataa

DBGET integrated database retrieval system