KEGG   Bacillus anthracis A0248: BAA_3715Help
Entry
BAA_3715          CDS       T00892                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00071  Fatty acid degradation
bai00072  Synthesis and degradation of ketone bodies
bai00280  Valine, leucine and isoleucine degradation
bai00310  Lysine degradation
bai00362  Benzoate degradation
bai00380  Tryptophan metabolism
bai00620  Pyruvate metabolism
bai00630  Glyoxylate and dicarboxylate metabolism
bai00640  Propanoate metabolism
bai00650  Butanoate metabolism
bai00900  Terpenoid backbone biosynthesis
bai01100  Metabolic pathways
bai01110  Biosynthesis of secondary metabolites
bai01120  Microbial metabolism in diverse environments
bai01130  Biosynthesis of antibiotics
bai01200  Carbon metabolism
bai01212  Fatty acid metabolism
bai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAA_3715
   00630 Glyoxylate and dicarboxylate metabolism
    BAA_3715
   00640 Propanoate metabolism
    BAA_3715
   00650 Butanoate metabolism
    BAA_3715
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAA_3715
   00072 Synthesis and degradation of ketone bodies
    BAA_3715
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAA_3715
   00310 Lysine degradation
    BAA_3715
   00380 Tryptophan metabolism
    BAA_3715
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAA_3715
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAA_3715
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAA_3715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bai04147]
    BAA_3715
Enzymes [BR:bai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAA_3715
Exosome [BR:bai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAA_3715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACQ49255
Position
complement(3388402..3389493)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGMERAIDDVILGNVVGPGGNV
ARLSALEAGLGHHIPGVTIDRQCGAGLEAIRTACHFIQGGGGKCYIAGGVESTSTSPFQN
RARFSPETIGDPNMGVAAEYVAESYNITREMQDEYACLSYKRTLQALAKGYIHEEILSFN
GLLDESIKPEMNYERIIKRTKPAFLHNGTVTAGNSCGVNDGACAVLVMEEGQARKLGYKP
VLRFVRSAVVGVDPNLPGTGPIFAVNKLLNERNMKVEDIDYFEINEAFASKVVACAKELQ
IPFGKLNVNGGAIALGHPYGASGAMLVTRLFYQAKRERMKYGIATLGIGGGVGLALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaagcgaaaaggacacctattggtaagaagaatgggatg
ttaaaagactatgaagttcagcaattagcagcaccgcttcttacatttttaagtaaagga
atggagagagcgatagacgatgtcatattagggaatgttgttgggccaggagggaatgtt
gcgagattatctgctttagaagcagggcttggtcatcatattccgggtgtaacgattgac
cgacaatgtggtgccggattggaagcgattcgcaccgcatgtcatttcattcaaggcggg
ggcggtaagtgttatatcgccggaggagtagagagtacaagtacgtcaccttttcaaaat
agggcgcgattttcaccagaaacaattggcgatcctaatatgggagtagcggctgagtat
gttgcagaaagttataacatcacgagagaaatgcaagacgagtatgcatgcctcagttat
aaacgaacactgcaagcattagcaaaaggatatatacatgaggaaatattgtcttttaat
ggattgctagatgaatccattaagccagaaatgaattatgaacgaatcattaaaagaaca
aaacctgcatttttacacaatggtacagtaacggcaggtaattcgtgcggtgtaaatgat
ggagcatgtgccgttcttgtaatggaagagggacaagcccgaaaattaggatacaagcct
gtacttcgtttcgttcgtagtgctgtagttggagtggatcctaaccttccggggactggt
ccgatatttgcggtgaacaaattattaaacgaaaggaatatgaaagtagaggacatcgat
tattttgaaataaatgaagcatttgcctcaaaagttgtagcttgtgcaaaggagttacaa
attcctttcggaaaattaaatgtaaatggtggggcaattgcgcttggtcatccgtacggt
gcatctggggctatgcttgtaacgcgcttgttttatcaggcgaaacgagagcgtatgaaa
tatggaatcgcaacgttaggaatagggggcggggtaggtcttgcactattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system