KEGG   Bacillus anthracis A0248: BAA_4262Help
Entry
BAA_4262          CDS       T00892                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00071  Fatty acid degradation
bai00072  Synthesis and degradation of ketone bodies
bai00280  Valine, leucine and isoleucine degradation
bai00310  Lysine degradation
bai00362  Benzoate degradation
bai00380  Tryptophan metabolism
bai00620  Pyruvate metabolism
bai00630  Glyoxylate and dicarboxylate metabolism
bai00640  Propanoate metabolism
bai00650  Butanoate metabolism
bai00900  Terpenoid backbone biosynthesis
bai01100  Metabolic pathways
bai01110  Biosynthesis of secondary metabolites
bai01120  Microbial metabolism in diverse environments
bai01130  Biosynthesis of antibiotics
bai01200  Carbon metabolism
bai01212  Fatty acid metabolism
bai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAA_4262
   00630 Glyoxylate and dicarboxylate metabolism
    BAA_4262
   00640 Propanoate metabolism
    BAA_4262
   00650 Butanoate metabolism
    BAA_4262
  Lipid metabolism
   00071 Fatty acid degradation
    BAA_4262
   00072 Synthesis and degradation of ketone bodies
    BAA_4262
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAA_4262
   00310 Lysine degradation
    BAA_4262
   00380 Tryptophan metabolism
    BAA_4262
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAA_4262
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAA_4262
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAA_4262
Enzymes [BR:bai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAA_4262
Exosome [BR:bai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAA_4262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACQ48412
Structure
PDB: 

Position
complement(3881294..3882469)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagtggatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgttgttgcaggtggagtagaagcaatgagttca
agcccctatgcattgaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gatattacagcagaaaaattagctgggttaaaaccagctttccgtaaagatggatctgta
acggcagggaatgcatctggcctgaatgacggaagcgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatggggattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaagtgaatgtaaatggt
agtggtgtaggacttggacatccaattggttgtacaggagctcgtattactgtaagttta
attcatgaattaaaaagacgcgggttagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggagtagcattatttatagaagcactataa

DBGET integrated database retrieval system