KEGG   Bacillus anthracis A0248: BAA_5188Help
Entry
BAA_5188          CDS       T00892                                 

Gene name
gtaB
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00040  Pentose and glucuronate interconversions
bai00052  Galactose metabolism
bai00500  Starch and sucrose metabolism
bai00520  Amino sugar and nucleotide sugar metabolism
bai01100  Metabolic pathways
bai01130  Biosynthesis of antibiotics
Module
bai_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAA_5188 (gtaB)
   00052 Galactose metabolism
    BAA_5188 (gtaB)
   00500 Starch and sucrose metabolism
    BAA_5188 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BAA_5188 (gtaB)
Enzymes [BR:bai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAA_5188 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACQ46890
Position
complement(4677191..4678078)
Genome map
AA seq 295 aa AA seqDB search
MKRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKT
KRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEG
RRYQVRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEI
QRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILEEQTNQES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtaagaaaagcgataatcccagcagctggattaggaacacgttttttacca
gctacaaaagcaatgccaaaagaaatgttaccgattgttgataaaccaactatccaatac
attgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaaacg
aagcgttctattgaagatcattttgataatgcatttgagttagagcaaaacttattagaa
aagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtagacattcac
tatatccgtcaaaaagaaccaaaaggattaggtcacgctgtttggtgtgcacgtaaattc
atcggtgatgagccatttgctgttttattaggtgatgatatcgttcaagctgaaaaacca
tgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggtgtacaa
acggttccagaagacgaaacacaccgctacggaattattgatccgttagagcaagaagga
cgtcgttaccaagttcgcaatttcgttgagaaaccagcagcaggtacagcaccttcaaac
ttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagaacaacaa
catgttggtgctggtggtgaaatccagttaacagatgctattcaaagcttaaacgaaatt
caacgtgtattcgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagctagga
ttcgttcaaacgacaatcgaaatggcactgcaacacccagaattacgtgatgacatggtt
acgatgatgaagaaaattttagaagaacaaacgaatcaagagtcttaa

DBGET integrated database retrieval system