KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_182Help
Entry
BCTU_182          CDS       T01528                                 

Gene name
trpc
Definition
(GenBank) indole-3-glycerol phosphate synthase (IGPS) / N-(5'-phospho-ribosyl)anthranilate isomerase (PRAI)
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
baj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
baj01100  Metabolic pathways
baj01110  Biosynthesis of secondary metabolites
baj01130  Biosynthesis of antibiotics
baj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCTU_182 (trpc)
Enzymes [BR:baj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCTU_182 (trpc)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     BCTU_182 (trpc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI Flg_bbr_C
Motif
Other DBs
NCBI-ProteinID: AEH39767
UniProt: F7WZA8
Position
complement(218559..219935)
Genome map
AA seq 458 aa AA seqDB search
MNSNTLNNILHYKNEWIKLHKLKKPLESFYSNIKNQKFLKRNTKNNPAFILECKKASPSI
GLLRTKFNIPKIIQVYKKYASAISIVTENKFFKGKFKYLKQASQCTNKPLLCKDFFIDPY
QIYYARYYQADAILLMMSILSNSQYVIMSNVAKKMNIDIVTEVHNISELHRALSLNADII
GINNRNLKNLSIDLKTTCRIAPLVPSDRIVISESGINKYKQIRMLSRYVNGFLIGSHLMK
SNSLKKTVCSMIYGKNKVCGLTRVEDAFIVKKSGSIYGGLFFYKSPRYIKLRDCKKITSQ
VKLKYVGVFYNSCMKYILSRVIKLSLAVVQLHGQENQDYIKKLRSLLPKNVKIWKALPVF
NNFPIERYNYINCYLIDHKNGGTGKNLIGILLKKNNVSKMMLAGGLKLNNIFQASTLGFC
GLDLNSGLEISPGIKDSKKIRHAFNIIKNFPAQYILKN
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaatacattaaataatatattacactataaaaatgaatggataaaactacat
aaattaaaaaagccattagaatcattttatagcaatataaaaaatcaaaaatttttaaaa
agaaatacaaaaaataacccagcatttattttagaatgtaaaaaagcttctccttctata
ggactattaagaactaagtttaatattccaaaaatcatccaagtttataaaaaatatgcc
agtgcaatatctattgtgacagaaaataaattttttaaaggtaaatttaagtatttaaaa
caagcatctcaatgcactaataaacctctcttatgtaaagatttttttatagatccatat
caaatttattacgctagatattatcaagccgatgctattttattaatgatgtctatttta
agtaattctcaatatgttattatgtctaatgtagcaaaaaaaatgaatatcgatattgtt
acagaagtacataacatatcagaattacatcgtgcattatcacttaatgcagatataatt
ggaattaataatagaaatttaaaaaatttatctatagatttaaagacaacatgtcgtatc
gcacctctagttccttcagatcgaattgttatttctgaatccggaattaataaatataaa
caaattcgtatgttaagtcgttacgttaatggatttttaataggtagtcatttaatgaaa
tccaattctcttaaaaagactgtatgtagcatgatatatggaaagaacaaggtatgcgga
ttaacaagagtagaagacgcatttattgtaaaaaaaagcggtagcatctatggaggttta
tttttttataaatctcctcgatatatcaaactacgcgattgcaaaaaaataactagtcaa
gttaaattaaaatatgttggagttttttataattcttgtatgaaatatattttatccaga
gtaataaaattatctttagcagtagtccaattacatggacaagaaaatcaagattatatt
aaaaaattacgcagtttactaccaaaaaatgtaaagatctggaaagcgttaccagttttt
aataattttcctatagaaagatataactatataaattgttatttaatagaccataaaaat
ggaggtaccggaaaaaatttgattggaatattattaaaaaaaaataatgtttccaagatg
atgttagcaggaggtttaaaattaaataatatatttcaagcatcgactttaggtttttgt
ggcttagatttaaattcaggattagaaatttctccgggaattaaagattctaaaaaaatt
agacacgcgtttaatattataaaaaattttccagcacaatatatattaaaaaactaa

DBGET integrated database retrieval system