KEGG   Buchnera aphidicola JF99 (Acyrthosiphon pisum): CWS_00550Help
Entry
CWS_00550         CDS       T02354                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bajc  Buchnera aphidicola JF99 (Acyrthosiphon pisum)
Pathway
bajc00450  Selenocompound metabolism
bajc00970  Aminoacyl-tRNA biosynthesis
bajc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bajc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CWS_00550
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CWS_00550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bajc01007]
    CWS_00550
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bajc03016]
    CWS_00550
Enzymes [BR:bajc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CWS_00550
Amino acid related enzymes [BR:bajc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CWS_00550
Transfer RNA biogenesis [BR:bajc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CWS_00550
 Prokaryotic type
   Other AARSs
    CWS_00550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADP67085
Position
113981..115624
Genome map
AA seq 547 aa AA seqDB search
MSSVFRKILVTCALPYANGSIHIGHMLEHIQADIWVRYHRMRGHEVWFVSADDAHGTAIM
LKAQDLEISPNKLIKNIRIEHQIDFSNFKISHDNYYSTHSLENLYLSRKIFTCLNEKGLI
KEKKIFQLYDTVKKIFLPDRFIKGTCPICKSKNQYGDNCEICSATYEPTDLINPISVISG
KKPILKNTKHLYFDLPSFTNMLKKWIHSGVLEESVIKKTEEWFKVGLKSWAISRDAPYFG
FKIPNYPNKYFYVWLDAPIGYISAFKNLCFKSKKLNFNELWNQNSNYELYHFIGKDIIYF
HTLFWPAILEAVSFRQPSGIFVHGHLTMNGLKLSKSRGALIKASDWIQYFDSDSLRYYYA
SKLSNKTHDIEINLEDFIQKINSDIVNKLVNLAARNASFINKYFNGYLSDKLSNIKLYKY
FVNTSSSIEDFFENREFSFIVKESMRLLDVANQYINEKKPWKIKRTEENIRELQNICTMG
INLFRIIMIFLKPIVPDLAIKTESFLISKLTWDGIKKPLLSHQINKFFPLYKRIDVEKMF
EFMNICR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtgtatttagaaaaattttagttacctgtgctttaccttatgctaatggttct
attcacattggccatatgttagaacatattcaagcagatatttgggtgcgttatcataga
atgcgtggtcacgaagtatggtttgtttctgctgatgatgcacatggtactgctataatg
ttaaaagctcaagatttagaaatatctcctaataaattaattaaaaatattaggatagag
catcaaatagatttttcgaattttaaaatttctcatgataattattattcaactcatagt
ttagaaaatttatatttatcaagaaaaatttttacatgtttaaatgaaaaaggtttaatt
aaagaaaaaaaaattttccaactttatgatacagtaaaaaaaatttttcttccagacaga
tttataaaaggtacatgcccaatttgtaaatcaaaaaatcaatatggtgataactgtgaa
atatgtagtgcaacttatgagcctacagatttaattaatccaatctctgttatttcagga
aaaaaacctattttaaaaaacactaaacatttatattttgatttaccttcttttactaat
atgttaaaaaaatggatacattctggtgttttagaagaatcagttattaaaaaaacagaa
gaatggtttaaagtaggtttaaagtcgtgggctatttctcgtgatgcaccttattttggt
tttaaaattccaaattatcctaacaaatatttttatgtttggcttgatgctccgatcggt
tatattagtgcgtttaaaaatctttgttttaagagtaaaaaattaaattttaatgaactt
tggaaccaaaattctaattatgaattataccattttattggtaaagatattatttacttt
catactttattttggcctgcaatattagaagctgtttcttttagacagcctagtggaatt
tttgttcatggacatcttactatgaatggactgaaattgtcaaaatccagaggtgctttg
attaaagctagtgattggattcagtatttcgattccgatagtttgcgttattattatgca
agcaagttatctaataaaacccatgatattgaaattaatttagaagactttattcaaaaa
ataaatagtgatatcgtaaataaactagtaaatttagcagcaagaaatgccagttttatt
aataaatattttaatgggtatttatctgataaattaagcaatataaaattatataaatat
tttgttaatactagtagtagtattgaagatttttttgaaaatcgcgaatttagttttata
gttaaagaatcaatgagattattagatgtagccaatcaatatattaatgaaaaaaaacca
tggaaaattaaaagaacagaagaaaatatcagggaattacaaaatatttgcacaatgggt
attaatttatttagaattataatgatttttttaaaacctatagtacctgatttagcaatc
aaaacagagtctttcttgatttctaaattgacttgggatggtattaaaaaaccattatta
tctcatcagataaataaattttttccattatataaaagaattgatgtcgaaaaaatgttt
gaattcatgaatatatgtagataa

DBGET integrated database retrieval system