KEGG   Buchnera aphidicola JF99 (Acyrthosiphon pisum): CWS_01010Help
Entry
CWS_01010         CDS       T02354                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bajc  Buchnera aphidicola JF99 (Acyrthosiphon pisum)
Pathway
bajc00260  Glycine, serine and threonine metabolism
bajc00750  Vitamin B6 metabolism
bajc01100  Metabolic pathways
bajc01110  Biosynthesis of secondary metabolites
bajc01120  Microbial metabolism in diverse environments
bajc01230  Biosynthesis of amino acids
Module
bajc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bajc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CWS_01010
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CWS_01010
Enzymes [BR:bajc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CWS_01010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N SAGA-Tad1 PRMT5_C
Motif
Other DBs
NCBI-ProteinID: ADP67167
Position
complement(207022..208311)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKNHNEQVNFETAVKLGLGQQQGLFFPVELPTITPIELSKILKMDFITRSTEILS
KFICHEISKEELYKHVKQAFSFKHPLKIKITKDIHCFELFHGPTLAFKDFGARFMAQMIL
LLNKKNESVTILTATSGDTGAAVANAFYGMKNVRVIILYPKGKISELQEKLFCTLGRNIK
TISINGSFDDCQKLVKEAFNDKKLKESIGLNSANSINISRLLAQICYYFEAFSLISEEQR
KNLVIAVPCGNFGNLTAGLLSKSLGLPIKSFIACTNANDTVPRFLNNGTWNPKKTVSTIS
NAMDISQPNNWTRIEELFYRKKWDLKKLRFGSVSDHTTEETLKELFKLGYVSEPHAAIAY
RLLRDQLKENEFGLFLGTAHPAKFKNTVEKILKNKISLPSELQNRIDLPLLSHNINPVFS
KLKTFLLEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacaatttaaaaaaccataacgaacaagtaaattttgaaacagccgtaaaa
ttaggattaggtcagcaacaagggttgtttttccctgtagaattacctactattactcct
attgaattatcaaaaatattaaaaatggattttattactcgcagtactgaaatactttct
aaattcatttgtcatgaaatatctaaagaagaactatataaacatgttaaacaagcattt
tcatttaaacatccattaaaaataaaaattacaaaagatatacattgcttcgaactgttt
cacggtccaacattggcgtttaaagattttggagctcgttttatggctcaaatgatatta
ttactaaataaaaaaaatgaatcagttactattttaactgcaacatcaggtgatacaggt
gcagcggtagcaaatgcattctatggaatgaaaaatgtgcgagtaattattttatatcct
aaaggcaagatcagtgaattacaagagaaattattttgtactttaggtagaaatataaaa
actatatcaattaatggtagttttgacgattgtcaaaaattagtaaaagaagcttttaac
gataaaaaactgaaagaatcaataggattaaattcagctaattcaattaatataagtaga
ttattagcacaaatctgttattattttgaagctttctctttaatttcagaagaacaaaga
aaaaatttagtaatagcagttccatgcggtaattttggaaatttaacagctggattatta
tctaaatctcttggtttgccaatcaaatcatttatagcatgtacgaatgcgaatgatacc
gtaccaagattccttaataatggcacgtggaatcctaaaaaaactgtatctacaatttct
aatgctatggatatcagtcaacctaataattggactcgaattgaagaattattttatcga
aaaaaatgggatttaaaaaaacttaggtttggaagtgtatcggatcatactacagaagaa
acattaaaagaactatttaaattaggttatgtttctgaacctcatgcagcaatagcatat
agattgttgcgagatcaattaaaagaaaatgaatttggcttatttttaggcactgctcat
ccggctaaatttaaaaatactgtagaaaaaatattaaaaaataaaatttcactgccttct
gaactacaaaatagaattgatttaccattattatctcataatattaaccctgtttttagt
aaattaaaaacgtttttattagaaaaataa

DBGET integrated database retrieval system