KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_108Help
Entry
BAKON_108         CDS       T01825                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
bak00450  Selenocompound metabolism
bak00970  Aminoacyl-tRNA biosynthesis
bak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BAKON_108 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAKON_108 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bak01007]
    BAKON_108 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bak03016]
    BAKON_108 (metG)
Enzymes [BR:bak01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BAKON_108 (metG)
Amino acid related enzymes [BR:bak01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BAKON_108 (metG)
Transfer RNA biogenesis [BR:bak03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BAKON_108 (metG)
 Prokaryotic type
   Other AARSs
    BAKON_108 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AEO08472
UniProt: G2LMI4
Position
114115..115758
Genome map
AA seq 547 aa AA seqDB search
MSITLRKILVTCALPYANGPIHIGHMLEHIQADIWVRYHRMRGREVWFISADDAHGTAIM
LKSKDLGISSNKLIKNIRKEHQIDFLNFKISHDNYYSTHSLENLYLLRKIFACLKEKDLI
KEKEIFQFYDNVKNIFLPDRFIKGTCPTCQSKNQYGDNCEICSATYEPIDLIDPISVISG
KKPILKNTKHLYFNLPFFSDMLKKWIHSGVLENSVIKKTEEWFKVGLKPWGISRDAPYFG
FKIPKYPDKYFYVWLDAPIGYMSAFKNLCFKNKKLNFDQFWNQKSNYELYHFIGKDIIYF
HTLFWPAILEAISFRKPSGIFVHGYLTMNGLKLSKSRGALIRASDWIQCFDSDSLRYYYA
SKLSNKTHDIEINLEDFIYKINSDIVNKLVNLASRSSSFIEKHFNGYLSNKLNNMQLYQY
FINASSNIENFLENREFNFVVKESMRLLDVANQYINEKKPWKIEKIEKNFTNLQEICTMG
INLFRIIMIFLKPIIPDLAIKTESFLISKLTWDSIKKPLLSHKINKFIPLYKRISMEKIS
ELINLYR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattacacttagaaaaattttagtcacctgtgctttgccttacgcaaatggtcct
attcatattggccacatgttagagcatattcaggcagatatttgggttcgttatcataga
atgcgtggtcgtgaagtatggtttatttctgctgatgatgcacacggtactgctataatg
ttaaaatctaaagatttaggaatatcttcaaacaaattaattaagaatatcagaaaagaa
catcaaatagattttttgaattttaaaatttcacatgataattattattcaactcatagt
ttagaaaacttatatttattaagaaaaatttttgcatgtttaaaagaaaaagatttaatt
aaagaaaaagaaatttttcaattttatgataatgtaaaaaatatttttcttccagatcga
tttattaaaggcacatgcccgacttgtcaatctaaaaaccaatatggtgataattgcgaa
atatgtagtgcaacttatgaacccatagatttgattgatccaatatctgttatttcaggg
aaaaaacctattttaaaaaatacaaaacatttatatttcaatctgcctttttttagtgat
atgttaaaaaaatggatacattctggtgttttagaaaattcagttattaaaaaaacagaa
gaatggtttaaggtaggtttaaagccatggggtatttctcgagacgcaccttattttgga
tttaaaattccaaaatatcctgataaatatttttatgtttggcttgatgctcctattggt
tatatgagtgcgtttaaaaatctatgttttaaaaataaaaaattaaattttgatcaattt
tggaatcaaaaatctaattacgaattataccattttattggtaaagatattatttatttt
catactttattttggcctgcaatattagaagctatttctttcagaaaacccagtggtatt
tttgttcatggttaccttactatgaatggattaaaattgtcaaaatcacgaggtgcttta
attagagcaagcgattggattcagtgttttgattcagatagtttacgttattattatgct
agtaagttatctaataaaactcatgatattgaaattaatttagaggattttatatataaa
ataaacagtgatattgtaaataaattagttaatttagcgtcaagaagttctagttttatt
gaaaaacattttaatggatatttatctaataaattaaataatatgcaattatatcaatat
tttattaatgccagtagtaacattgaaaattttttagaaaatcgtgaatttaattttgtt
gtgaaagagtctatgagattattagatgtagctaatcaatatattaatgaaaaaaaacca
tggaaaatagaaaaaatagagaaaaattttactaatttacaagaaatttgtacaatgggt
attaatttatttagaattattatgatttttttaaaaccgataatacctgatttagcaatt
aagacagaatcttttttaatttcaaaattaacttgggatagtattaagaaaccactttta
tctcataaaataaataaatttattccattatataaaagaattagtatggaaaaaatttct
gaattaattaatctatatagataa

DBGET integrated database retrieval system