KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_279Help
Entry
BAKON_279         CDS       T01825                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
bak00260  Glycine, serine and threonine metabolism
bak00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bak01100  Metabolic pathways
bak01110  Biosynthesis of secondary metabolites
bak01130  Biosynthesis of antibiotics
bak01230  Biosynthesis of amino acids
Module
bak_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAKON_279 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAKON_279 (trpA)
Enzymes [BR:bak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAKON_279 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG
Motif
Other DBs
NCBI-ProteinID: AEO08629
UniProt: G2LMZ1
Position
complement(302733..303542)
Genome map
AA seq 269 aa AA seqDB search
MNRYQIMFKRLSLLKEGCIIPFVVLGDPSLEISIKIIEALIENGADALEVGIPFSDPLAD
GPTIQKANLRALSKKNTFFEYFQILKKIREKNEKIPIGVLIYANLVYNQGIDNFYLQCFD
SGLDSVLIADVPIEESKVFYKTANKHQINSIFMCPPDADKNFLHKISSYAQGFIYVLSRA
GVTGIENKTFSLPTSFIKKIKKYNSIPLLQGFGISNPKQVKEAMLSGLSGIICGSAIIHI
IEKYLNQEDEMIKKIKRFINSLKLSSKLK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgatatcagataatgtttaaaagattatctttgttaaaagaaggatgtattata
ccttttgtggttttaggggatccttctttagaaatatcaataaaaattattgaagcattg
attgaaaatggagctgatgctttagaggttggaattccattttcagatccattagctgat
ggaccaactattcaaaaagcaaacttacgagccttatctaaaaaaaatactttttttgaa
tactttcaaatattaaaaaaaatacgcgaaaaaaatgaaaaaatacctattggtgttttg
atatatgccaatcttgtatataatcaaggtattgataatttttatttgcaatgttttgat
tctggtttagattctgttcttatagcagatgttccaattgaggaatcaaaagttttttat
aaaactgcaaataagcaccagattaattctatttttatgtgtcctccggatgcagataaa
aattttttacataaaatttcttcatatgcacaaggatttatttatgtattatctcgtgcg
ggagtaacaggtattgaaaataaaactttttcgttacctacaagttttataaaaaaaata
aaaaaatacaattctattcctttattacaaggttttggtatttcaaatcctaaacaagtt
aaagaagcaatgttatcaggtttatctggcataatatgtggttcagcaattatacatatt
attgaaaaatatttaaatcaagaagatgaaatgattaaaaaaataaaaagatttattaat
tcattaaaattgtctagtaaattaaaataa

DBGET integrated database retrieval system