KEGG   Bacillus cereus biovar anthracis CI: BACI_c00450Help
Entry
BACI_c00450       CDS       T01279                                 

Gene name
metRS
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00450  Selenocompound metabolism
bal00970  Aminoacyl-tRNA biosynthesis
bal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BACI_c00450 (metRS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BACI_c00450 (metRS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bal01007]
    BACI_c00450 (metRS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bal03016]
    BACI_c00450 (metRS)
Enzymes [BR:bal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BACI_c00450 (metRS)
Amino acid related enzymes [BR:bal01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BACI_c00450 (metRS)
Transfer RNA biogenesis [BR:bal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BACI_c00450 (metRS)
 Prokaryotic type
   Other AARSs
    BACI_c00450 (metRS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ADK02847
UniProt: D8GWI4
Position
41213..43195
Genome map
AA seq 660 aa AA seqDB search
MTEENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQ
KKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDI
YLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYV
DRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWV
DALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFA
HGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINF
DLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFS
VALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVA
PSKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKGQPIFPRLEMDVEVAYIKEQMKASA
PKVEEKKEEEPKAEEITIDDFFKVELRVAEVLSAEPVKKADKLLKIQLDLGTEKRQVVSG
IAKFYSPEDLKGKKVICVTNLKPVKLRGELSQGMILAGEENGVLSLASIDQNLPNGTKIK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggaaaacaaatccttttatattactaccccaatttattatccaagtggaaaa
ttacacattggacatgcttatacaacagtagcaggagatgcgatggcacgatataagcgt
atgcaaggatataatgttcattatttaacaggaactgatgagcatggacagaagatccaa
aagaaagcagaagaattaaacgttacaccacaagcatatgtggataacatcgttgcagga
attaaagaactttgggaaaagatggatatctcttatgatgattttattcgtacaacggaa
gatcgtcataaagatgttgttgaaaaaatcttcaagcaactagtagatcaaggtgatatt
tatcttgatgaatatgaaggttggtattctgtacaagatgagacattctatacggagcat
caattagtagatccaattatggaaggtgacaaagtagttggaggaaaaagtccagatagt
ggtcatgatgtagaacttgttcgtgaagaatcgtatttctttagaatgggtaaatatgtc
gacagactattaaaattctatgaagataatccacatttcattcagccagagtctcgtaag
aatgaaatgattaataacttcattaaaccaggcttagaagatttagcagtttctcgtact
tcatttgactggggagttcgtgttccaggtaatccgaaacacgttatttacgtatgggtt
gacgcactatctaactacattacagcattaggttatggaacagaaaatgaagagatgtat
aagaagttctggccggcagatgtgcatttagttggaaaagaaatcgttcgtttccataca
atttattggccaatcattttaatggcattagatttacctcttccgaaaaaagtctttgct
cacggttggattttaatgaaggatggaaagatgagtaagtcaaaaggaaatgtagtagat
ccagttacattaatcgatcgttacggattagatgcattacgttattacttacttcgtgaa
gttccattcggatctgatggcgtattcacaccagaaggatttgtggagcgtattaatttc
gatttagcaaatgacttaggtaacttattaaatcgtacagtagctatgattgataagtac
tttaacggagaaatccctgcatttaaagcaaatgtaacggaatttgatgaaacgttagta
acatttgcgaaagatacattgaaaaaagttgaagaagcaatggagaatatggaattctct
gtagctctaagctcaatttggcaattggttagccgtacgaataaatatattgatgaaaca
caaccatgggtattagcgaaagatgaggatgatcgtgaaaagttggcgtctgtaatggct
catttagcagaagtacttcgtcaaacgggtattatgcttatgccattcttaacagtagca
ccaagcaaaatgtttgctcagcttggccttactgatgaagcacatacatcttggggaagc
ctatctacaatcggctgtattccagctggaacaaaagtagaaaaaggacaaccaattttc
cctcgtttagaaatggacgtggaagtggcgtacattaaagaacaaatgaaagcctctgct
cctaaagtagaagagaaaaaagaagaagaaccgaaggcagaagaaattacaattgatgat
ttctttaaagtagaattgcgtgtagctgaagtactatctgctgaacctgtaaaaaaggca
gataagttgttgaaaattcaactagacttaggtacagaaaagcgtcaagttgtttctgga
attgcaaaattctattcgccagaagacctaaaaggtaaaaaggttatttgtgtaacaaat
ttaaaacctgtaaaattacgcggtgaattatcgcaaggtatgattttagcgggtgaagag
aatggcgtattgtcattagcatctattgaccaaaatctaccaaatggtacaaaaatcaag
taa

DBGET integrated database retrieval system