KEGG   Bacillus cereus biovar anthracis CI: BACI_c05220Help
Entry
BACI_c05220       CDS       T01279                                 

Gene name
gsaB
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00860  Porphyrin and chlorophyll metabolism
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BACI_c05220 (gsaB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bal01007]
    BACI_c05220 (gsaB)
Enzymes [BR:bal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BACI_c05220 (gsaB)
Amino acid related enzymes [BR:bal01007]
 Aminotransferase (transaminase)
  Class III
   BACI_c05220 (gsaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ADK03255
UniProt: D8GZZ6
Position
complement(485666..486970)
Genome map
AA seq 434 aa AA seqDB search
MVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMERGKGAYFWDVDGNKYIDY
LAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKEAMPALDKVRFVNSG
TEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQE
VITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVI
YDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLGPAYQA
GTMAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGILEQAAKHNIDITLNRLKGAL
TVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAPSKYEAWFLTTEHTKEDIEYTI
EAVGRAFAALADNK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgaaattcacaaaatcagaagcattacataaagaagctttagaacatatcgtt
ggcggtgttaatagtccttcgcgttcttttaaagcagttggcggtggcgctcctgttgct
atggaacgtggaaaaggtgcttatttctgggatgtagacggaaataaatatatcgattat
ttagcagcatacggccctattattactggacatgctcacccgcacatcaccaaggcaatt
acaacagctgctgaaaatggggtactttacggaactccaacagcactagaagtaaaattt
gcaaaaatgttaaaagaagcaatgcctgcattagataaagtccgcttcgtaaattctggt
actgaagctgtaatgacaacaattcgtgtcgctcgtgcttacacaggccgcacaaaaatc
atgaaatttgctggttgttaccacggtcattctgatttagtacttgtagcagctggatct
ggcccttctacactaggaactcctgactcagccggtgtaccacaaagtattgctcaagaa
gttattactgttccatttaataatgtagaaactttaaaagaagcactagataaatgggga
catgaggtagcagctattcttgtagaaccgattgttggaaacttcggtattgtagagcca
aaacctggcttccttgagaaagtgaatgaacttgtgcacgaagctggtgcactagtaatt
tacgatgaagttattaccgctttccgcttcatgtacggtggtgctcaagacttacttggc
gtaacaccagacttaacagcgcttggtaaagttattggcggcggacttccaatcggtgct
tacggtggtaagaaagaaattatggaacaagttgccccgctcggacctgcatatcaagct
ggtacaatggcaggaaatcctgcttctatggcatctggtattgcttgtctagaagttctt
caacaagaagggctttatgaaaaattagatgaacttggtgcaatgcttgaaaaaggaatt
ttagagcaagctgcaaaacataatatcgatattacattaaaccgtctaaaaggtgcttta
actgtatacttcacaacaaatacaattgaagattacgatgcagcacaagatacagatggg
gaaatgttcggcaaattctttaagctaatgcttcaagaaggagttaacttagccccttct
aaatacgaggcatggttcttaacaacagagcatacaaaagaagatattgaatatacaatt
gaagctgtaggcagagcatttgctgctttagcagacaataaataa

DBGET integrated database retrieval system