KEGG   Bacillus cereus biovar anthracis CI: BACI_c29290Help
Entry
BACI_c29290       CDS       T01279                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00020  Citrate cycle (TCA cycle)
bal00620  Pyruvate metabolism
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
bal01130  Biosynthesis of antibiotics
bal01200  Carbon metabolism
Module
bal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BACI_c29290 (mqo)
   00620 Pyruvate metabolism
    BACI_c29290 (mqo)
Enzymes [BR:bal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BACI_c29290 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase HI0933_like FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ADK05552
UniProt: D8H292
Position
2748458..2749960
Genome map
AA seq 500 aa AA seqDB search
MSNMQQKTDVILIGAGIMSATLGSLLKELAPEWEIKVFEKLASAGEESSNEWNNAGTGHS
ALCELNYTSEKSDGSIDISKAVKVNEQFQLSRQFWAYLVKSKLIRNPQDFIMPLPHMSLV
QGEKNVEFLKNRFEALSKNPLFQGMEFSDAPETLKKWLPLIMEGRTSNEPMAATKIDSGT
DVNFGALTRMLFDYLKTKDVELNYKHSVENIKRTKNGLWEVKVHDMNSGKIEHHTAKFVF
IGGGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCKNQKVVEQHHAKVYGKAKVGAPPMSV
PHLDTRYIDNKKALLFGPFAGFSPKFLKTGSNLDLIGSVKPNNVLTMLAAGVKEMGLTKY
LIQQVMLSHEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTDAGGKGTLQFGTEVVSA
ADGSIAALLGASPGASTAVHVMLEVLEKCFPSRMVEWEGKIKEMIPSYGISLTENPRLFQ
DLHTSTGRTLGLNEKETVHN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatgcagcaaaaaacagacgttatcttaattggtgcaggaattatgagtgca
acgttaggctcattactaaaagaattagcacctgaatgggaaattaaagtttttgaaaaa
ctcgcaagtgccggggaagaaagctctaacgaatggaataatgcaggtacagggcattct
gcgctatgcgaactgaactatacttccgaaaaatctgacggatctatagatattagtaag
gctgtaaaagtgaatgagcaattccagctttcaagacaattttgggcatatcttgtaaaa
agcaaactaattcgtaatccacaagattttattatgcctctacctcatatgagtttagta
caaggtgaaaaaaatgttgagtttctaaaaaaccgttttgaagcgctttcaaaaaatcca
ctgtttcaaggaatggaattttccgatgctcctgaaacattaaaaaaatggcttccactc
attatggaaggtcgtacatctaatgaaccgatggctgcaacgaagattgactctggaaca
gatgttaacttcggtgcattaacacgtatgctgtttgattacttaaaaacgaaagatgtc
gagctaaactacaaacatagtgtcgaaaacattaaacgtacgaagaatggtttgtgggaa
gtgaaagtacacgatatgaatagtggtaaaatcgaacatcatactgcaaaattcgtcttt
atcggcggtggtggaggtagcctacctctcctacaaaagactggtattcccgaatcaaaa
catattgggggattcccagtaagtggactatttatggtatgtaagaaccaaaaagttgta
gagcaacatcatgcgaaagtatacggtaaagctaaagttggcgctccgccaatgtctgta
cctcaccttgatacgagatatatagacaacaaaaaagctttactatttggaccgttcgca
gggttctctcctaagttcttaaaaactggctcaaaccttgacttaatcggttctgtaaaa
ccgaataacgtcttaacgatgttagctgctggtgtaaaagaaatgggattaacaaaatac
ttaattcagcaagttatgttatcacatgaaaaacgtatggaagaattacgcgaattcatt
ccgaacgcgaaaagtgaagattgggatattgtagttgctggtcagcgtgtacaagtaatt
aaagatactgatgctggcggtaaaggaacacttcaattcggtacagaagttgttagtgcg
gctgatggatcaatcgcagcattactaggtgcttcaccaggtgcttctactgccgttcat
gttatgcttgaagtattagaaaaatgtttcccaagtcgaatggtagaatgggaaggaaaa
ataaaagaaatgattccttcttacggcatttcattaacagaaaatccaagattattccaa
gaccttcacacttctacaggtcgcacccttggattaaatgaaaaagaaacggttcataat
taa

DBGET integrated database retrieval system