KEGG   Bacillus cereus biovar anthracis CI: BACI_c31660Help
Entry
BACI_c31660       CDS       T01279                                 

Definition
(GenBank) NADPH-cytochrome P450 reductase
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00071  Fatty acid degradation
bal00380  Tryptophan metabolism
bal00627  Aminobenzoate degradation
bal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BACI_c31660
  Amino acid metabolism
   00380 Tryptophan metabolism
    BACI_c31660
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BACI_c31660
Enzymes [BR:bal01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BACI_c31660
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BACI_c31660
Cytochrome P450 [BR:bal00199]
 Cytochrome P450, bacteria type
  CYP102 family
   BACI_c31660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5 Alba NAD_binding_6 FMN_red
Motif
Other DBs
NCBI-ProteinID: ADK05784
UniProt: D8H3P1
Position
complement(2981507..2984704)
Genome map
AA seq 1065 aa AA seqDB search
MDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKLAEEYGPIFQIQTLSDTIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETDEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPKENVDVPGDMTRLTLDTIGLCGFNYRFNSFYRETSHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGNQEENDLLSR
MLNVKDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
VLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFEFIDYEDYQLDVKQTLTLKPGDFKIRIVPRNETISHTTVLAPTEEKLKNHETKQ
QVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVAALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQSMWSDAMKAFGLELNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSSSSERSTRHIEISLPEGATYKEGDHLGVLPI
NSEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVRLYDLLSYSVEVQEAATRAQI
REMVTFTVCPPHKKELESLLEEGVYQEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLVAQDRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFQLSENPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMKVGEAHLYFGCRHPEKDYL
YRTELENDEREGLISLHTAFSRLEGHPKTYVQHVIKEDRIHLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHQASEQEARNWLDRLQEEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaagtatctgccattcctcagccgaaaacatatggaccgctggggaatctc
ccattaatcgataaagataaaccgactctatcgtttattaagctggcagaagagtatggt
cctatttttcaaattcaaactttaagtgatacgatcattgtcgtttctggacatgaactg
gtagcggaagtttgtgatgaaacaagatttgataaaagtatagagggtgctttagcaaag
gttcgtgcttttgctggagacggactatttacaagcgagactgacgagcctaactggaaa
aaagctcataatattttgatgcctacattcagtcaacgggcaatgaaagattatcatgct
atgatggtcgatattgccgtgcaactcgttcaaaaatgggcaagactgaatccgaaagaa
aatgtagatgtcccaggggatatgactcgccttacattagatacaattggtctatgtggt
tttaattaccgatttaatagcttttatcgtgagacctctcatccttttatcactagcatg
acccgtgcgctagatgaggcgatgcaccaattgcagagactggatatagaagacaaactt
atgtggagaacgaaacgtcaatttcagcatgatattcaatctatgttttctttagtagat
aatattattgctgaacgtaaaagtagtggaaatcaggaagaaaatgatttactttcccgt
atgttaaatgtgaaggatccggaaacgggtgaaaaattagacgatgaaaatattcgtttt
caaattatcacttttttaatagctggacatgaaacaacaagtggattgttatcttttgca
atctattttttattaaagaatccggataaattgaaaaaagcctatgaagaagtagaccgt
gttttgacagatcccactccaacataccaacaagttatgaagcttaagtatatacggatg
attttaaatgaatcactacgtttatggccgactgctccagcattcagtctctatgcaaaa
gaagatacagtaattggtgggaaatatccaattaagaaaggcgaggatcgtatttctgtc
cttattccgcagctacatagggataaagacgcgtggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataaaccatttggaaat
ggtcagcgagcatgtatcggtatgcagtttgcacttcatgaagcgacacttgtaatggga
atgcttcttcaacattttgaattcatcgattatgaagactatcagctggacgtaaaacaa
acattaacgctaaagcctggtgattttaagattaggattgtacctcgaaatgaaactatt
agccatactactgttcttgcgcctacagaggagaaactgaaaaaccatgaaaccaagcag
caagttcagaaaactccttccattattggagccgataatctttcactgcttgttctgtat
ggttcggatacaggggtagcagaaggtattgcaagagaactagcagatacggctagttta
gaaggtgttcaaacggaagtggcagctcttaacgatcgaattggaagtttgccaaaagaa
ggagcggttcttattgtaacttcttcttataatggaaagccgccaagtaatgcagggcag
tttgtgcagtggctggaggaattaaaaccggatgagctaaaaggtgttcaatacgcagtt
tttggttgtggagatcataattgggctagtacttatcagcgaattccaagatacattgat
gagcaaatggctcaaaaaggagcaacaagattttctaaacgcggagaagcagatgcaagt
ggtgatttcgaggaacagctcgagcaatggaaacaaagtatgtggtctgatgcgatgaag
gcatttggattggaacttaacaaaaacatggagaaagaacgcagtactttgagcctgcaa
tttgtcagccgtcttggaggatctcctcttgcgcgaacatatgaagcagtttatgcatct
atactagaaaatcgtgaacttcaatcatctagcagtgaaagaagcacgcgacatattgaa
atatccttgccagaaggggctacatataaagaaggagaccaccttggggtactaccaatt
aatagtgagaaaaatgtcaaccgaattttaaaacgctttggattaaacgggaaggatcaa
gtcatattaagcgcaagtgggcgcagtgtaaatcacatacctttagacagtcctgttcgt
ttatatgaccttcttagttacagtgtcgaagtgcaagaagcagccactcgagcacaaata
cgagaaatggtgacattcacagtatgccctcctcataaaaaggaattggaatcattattg
gaagagggagtttatcaagaacaaatattaaagaaacgtatttcaatgttagatcttctt
gaaaagtatgaggcttgtgaaatccgatttgaacgctttttagaacttcttccggcgctc
aaaccgcgttactattctatctcaagttctccacttgttgcccaggatcgtctaagcatt
acggttggtgttgtaaatgcgcctgcatggagtggggaaggaacatatgaaggagtcgct
tctaattatttagctcagcgtcataataaagatgagattatctgtttcattcgaacgcca
caatcaaactttcaattatctgaaaatccagaaacaccaattatcatggttggaccaggc
actggaattgcaccattccgtggattcttacaagcgcgtcgtgttcaaaagcaaaaaggt
atgaaggtaggagaagcacatctatactttggttgtcgtcatcctgaaaaggattatctc
tatcgtacagaattagaaaatgatgaaagagagggattaatctctttacacacagctttt
tctcgcttagaaggacaccctaaaacatatgtacagcatgtaataaaagaagatagaatc
catttaatttcgttattagataatggggcccatctttatatatgtggtgatggaagtaaa
atggctcctgacgtagaagacaccctttgtcaagcctatcaagaaattcatcaagctagt
gaacaagaagcaaggaattggttagatcgtttgcaagaggaaggacgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system