KEGG   Bacillus cereus biovar anthracis CI: BACI_c35720Help
Entry
BACI_c35720       CDS       T01279                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00071  Fatty acid degradation
bal00072  Synthesis and degradation of ketone bodies
bal00280  Valine, leucine and isoleucine degradation
bal00310  Lysine degradation
bal00362  Benzoate degradation
bal00380  Tryptophan metabolism
bal00620  Pyruvate metabolism
bal00630  Glyoxylate and dicarboxylate metabolism
bal00640  Propanoate metabolism
bal00650  Butanoate metabolism
bal00900  Terpenoid backbone biosynthesis
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
bal01130  Biosynthesis of antibiotics
bal01200  Carbon metabolism
bal01212  Fatty acid metabolism
bal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BACI_c35720
   00630 Glyoxylate and dicarboxylate metabolism
    BACI_c35720
   00640 Propanoate metabolism
    BACI_c35720
   00650 Butanoate metabolism
    BACI_c35720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BACI_c35720
   00072 Synthesis and degradation of ketone bodies
    BACI_c35720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BACI_c35720
   00310 Lysine degradation
    BACI_c35720
   00380 Tryptophan metabolism
    BACI_c35720
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BACI_c35720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BACI_c35720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BACI_c35720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bal04147]
    BACI_c35720
Enzymes [BR:bal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BACI_c35720
Exosome [BR:bal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BACI_c35720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADK06186
UniProt: D8H6Q3
Position
complement(3379940..3381031)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGMERAIDDVILGNVVGPGGNV
ARLSALEAGLSHHIPGVTIDRQCGAGLEAIRTACHFIQGGAGKCYIAGGVESTSTSPFQN
RARFSPETIGDPNMGVAAEYVAESYNITREMQDEYACLSYKRTLQALAKGYVHEEILSFH
GLLDESIKPEMNYERIIKRTKPAFLQNGTVTAGNSCGVNDGACAVLVMEEGQARKLGYKP
VLRFVRSVVVGVDPNLPGTGPIFAVNKLLGEMNMKVEDIDYFEINEAFASKVVACAKELQ
IPYEKLNVNGGAIALGHPYGASGAMLVTRLFYQAKRERMKYGIATLGIGGGIGLALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaagcgaaaaggacacctattggtaagaagaatgggatg
ttaaaagactatgaagttcagcaattagcagcgccgcttcttacatttttaagtaaagga
atggagagagcaatagacgatgtcatattagggaatgttgttgggccaggagggaatgtt
gcgagattatctgctttagaagcagggcttagtcatcatattccgggtgtaacgattgac
cggcaatgtggtgccggattggaagcgattcgcaccgcatgtcatttcattcaaggcggg
gccggtaagtgctatatcgcgggaggagtagagagtacaagtacgtcaccttttcaaaat
agggcgcgattttcaccagaaacaattggcgatcctaatatgggagtagcggctgagtat
gttgcagaaagttataacatcacgagagaaatgcaagacgagtatgcatgcctcagttat
aaacgaacactgcaagcattagcaaaaggatatgtacatgaggaaatattgtcttttcat
ggattattagatgaatctataaagccagaaatgaattatgaacgaattattaaaagaaca
aaacctgcatttttacaaaatggtacagtaacggcaggtaattcgtgtggtgtcaatgat
ggggcatgtgctgttcttgtaatggaagagggacaagcccgaaaattaggatacaagcct
gtacttcgtttcgttcgtagtgttgtagttggagtggatcctaaccttccggggactggt
ccgatatttgcggtgaacaaattattaggcgaaatgaatatgaaagtagaggacatcgat
tattttgaaataaatgaagcgtttgcttcaaaagttgtagcttgtgcaaaggaattacaa
attccgtatgaaaaattaaatgtaaatggtggggcaattgcgctcggtcatccgtacggt
gcatctggggctatgcttgtaacgcgcttgttttatcaggcgaaacgagagcgtatgaaa
tacggaatcgcgacgttaggaatagggggcgggataggtcttgcactattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system