KEGG   Bacillus cereus biovar anthracis CI: BACI_c39970Help
Entry
BACI_c39970       CDS       T01279                                 

Definition
(GenBank) short chain dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00072  Synthesis and degradation of ketone bodies
bal00650  Butanoate metabolism
bal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BACI_c39970
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BACI_c39970
Enzymes [BR:bal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BACI_c39970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 3HCDH_N Epimerase Shikimate_DH Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADK06601
UniProt: D8H9F2
Position
3795870..3796646
Genome map
AA seq 258 aa AA seqDB search
MVTNRVVFLTGAASGIGYEMGNAFAKEGAKVVITDRLEERAKEAAEQLQKEGFQAIGLKC
DVTSEEEIEASISQTVTHFGSLDILINNAGMQHVSPIEDFPTEKFELLIKIMQIAPFIAV
KHAFPIMKKQKYGRIINVASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHGITVNA
LCPGYVDTPLVRNQLQDLATTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFLASEK
AKGITGQAVVIDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaatcgagttgtttttttaacaggtgctgcaagtggtattggatatgaaatg
ggaaacgcttttgcaaaagaaggggcaaaagttgttattaccgatcgtcttgaagaacgt
gcaaaagaagctgctgaacaactacaaaaagagggctttcaagctatcggcttaaaatgt
gatgttacatccgaagaagaaatagaagcatccatttctcaaactgttactcatttcggt
tcattagacatattaattaataatgcaggcatgcaacacgtttcaccaattgaagatttt
ccaaccgaaaaattcgagctactaattaaaattatgcaaatcgctccttttatcgccgtt
aagcatgcctttcccattatgaaaaagcaaaaatatggccgaattattaatgtagcttcc
attaatggcctcgttggattcgctggaaaagctgcttataatagcgcaaaacatggtgta
attggattaacaaaagttgccgctttagaaggggctactcacggaattactgttaatgcg
ctttgtcccggttatgtcgatacccctctcgtacggaatcaattacaagacttggccact
acacgaaatgtaccacttgaaaatgttttagaggatgtcatttatccacttgtcccacaa
aaacgcttattacaagtacaagagattgctgattatgcgatgtttttagcaagcgaaaaa
gctaaaggtataactggacaagcagtcgttatcgatggtggttataccgctcaataa

DBGET integrated database retrieval system