KEGG   Bacillus cereus biovar anthracis CI: BACI_c44500Help
Entry
BACI_c44500       CDS       T01279                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00860  Porphyrin and chlorophyll metabolism
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BACI_c44500 (hemB)
Enzymes [BR:bal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BACI_c44500 (hemB)
Exosome [BR:bal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BACI_c44500 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADK07042
UniProt: D8GX73
Position
complement(4200735..4201724)
Genome map
AA seq 329 aa AA seqDB search
MNSLQFNRHRRLRQSGNMRALVRETFLHTEDFIYPIFVLEGENVRNEVPSMPGVYQMSLD
LLQAEMQEVVDLGIRSVIVFGLPAEKDEVGSSAYCDHGIVQRAIQQIKGEFPDLVVVADT
CLCQFTSHGHCGVIEDGIILNDESLAVLAKTAVSQAKAGADIIAPSNMMDGFVTAIRHAL
DENGFGHVPVMSYAVKYSSAFYGPFRDAAHGAPQFGDRKTYQMDPANRMEAFREAESDVM
EGADFLIVKPALSYLDIVRDVKNNFNLPVVAYNVSGEYSMIKAAAQNGWINEKEVVLEKL
ISMKRAGADLIITYHAKDAARWLQEGGAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaactctttacaatttaatcgtcatcgtcgtttaagacaaagcggtaatatgcgtgca
cttgtgcgtgaaacgtttttacatacggaagattttatttaccctatttttgtattagaa
ggagaaaatgttcgtaatgaagtgccttctatgccaggcgtatatcaaatgtctttagat
ttactgcaagctgaaatgcaagaagttgttgatttaggtattcgttctgttattgtattt
ggtttacctgctgaaaaagatgaagttggatcatcagcatattgtgatcatggaattgtg
caacgtgcaattcagcaaattaaaggtgaatttcctgatctagtagtagttgcggataca
tgtttatgtcaattcacaagtcatggtcattgcggtgtaattgaagatggtattatttta
aatgatgagtctcttgcagttcttgcaaaaacagctgtaagccaagcgaaagcaggagcg
gacattattgcaccatctaacatgatggacggattcgtaacagcaattcgccacgcatta
gatgaaaatggttttggacatgtaccagttatgtcgtacgctgtgaaatattcatcagca
ttttacggaccattccgtgatgcggcacacggtgcaccgcaatttggtgatcgtaaaaca
tatcaaatggacccagcgaaccgcatggaagcattccgtgaagcagaatcagatgtaatg
gaaggggcagatttcttaattgtaaagccagctctttcatacttagatatcgttcgtgat
gtgaaaaataactttaatttaccagtcgttgcttataacgtgagcggtgaatattcgatg
attaaagcggcagcgcaaaatggttggattaatgaaaaagaagttgtacttgaaaaatta
attagcatgaaacgtgcaggagcagatttaattattacgtatcacgcaaaagatgcagca
agatggttacaagaaggaggcgctaaataa

DBGET integrated database retrieval system