KEGG   Bacillus cereus biovar anthracis CI: BACI_c44510Help
Entry
BACI_c44510       CDS       T01279                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthetase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00860  Porphyrin and chlorophyll metabolism
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BACI_c44510 (hemD)
Enzymes [BR:bal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BACI_c44510 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 AAA_8
Motif
Other DBs
NCBI-ProteinID: ADK07043
UniProt: D8GX74
Position
complement(4201745..4202497)
Genome map
AA seq 250 aa AA seqDB search
MNALAGKTVLITRAQHQAKQMSVAVKEKSGIPLEIPLLRMEGMSHRQIQHIAGQLHSYDW
VIFTSKNGVAFFLDRLRQKLPVTTKIAAVGVKTKLELEKRGYEVDFVPTSFVAEVFAEEF
VKRLSGNECILFPKGNLARDVIPVALRKIGVSLDELIVYGTKENVEKKRELIEVLEAEEV
DIITFTSPSTVTSFVHLLEGTNWREWTKKCTIACIGPITEKEASLYFPHVIMPKEYTVEA
LLQCVCESIK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctggcaaaacggtattgattacacgtgcccagcaccaagcaaaacaa
atgagtgtagcggtgaaagaaaagagcggaattccattggaaattccgcttttgcgtatg
gagggtatgtctcacaggcaaattcaacatatagcaggacagctacattcgtatgactgg
gttatttttacgagtaaaaatggggtagctttttttctagatcgtttgagacagaagcta
cctgtaacgactaaaattgctgcagtaggcgtgaaaacaaagttagagttagaaaagcga
ggctatgaagtggacttcgttccaacttcatttgttgcagaagtatttgcagaagagttt
gtaaaaagattaagtggaaacgaatgtattttatttccgaaagggaatttagcaagagat
gtaattccagttgcacttcgcaaaattggtgtttctctagatgagctaatcgtatatggt
acgaaagaaaatgtagagaaaaagcgagagcttatagaagtgttagaagcagaggaagta
gacattattacatttacgagtccttcaactgtcactagctttgttcatttacttgagggc
acaaactggagagaatggacaaaaaaatgtacaattgcttgtatagggcctattacggaa
aaagaggcgagcctttattttccgcatgttattatgccaaaagagtacactgtagaagca
ttactacaatgtgtttgtgaatctataaaataa

DBGET integrated database retrieval system