KEGG   Bacillus cereus biovar anthracis CI: BACI_c44770Help
Entry
BACI_c44770       CDS       T01279                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00471  D-Glutamine and D-glutamate metabolism
bal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BACI_c44770 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bal01011]
    BACI_c44770 (murI)
Enzymes [BR:bal01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BACI_c44770 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:bal01011]
 Precursor biosynthesis
  Racemase
   BACI_c44770 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Flu_M1
Motif
Other DBs
NCBI-ProteinID: ADK07067
UniProt: D8GX98
Position
complement(4224706..4225509)
Genome map
AA seq 267 aa AA seqDB search
MNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTEHL
LDLNIKMLVIACNTATAVVLEEMQKQLPIPVVGVIHPGSRTALKVTNTYHVGIIGTIGTV
KSGAYEEALKSINNRVMVESFACPPFVELVESGNFESEMAYEVVRETLQPLKNTDIDTLI
LGCTHYPILGPVIKQVMGDKVQLISSGDETAREVSTILYHSKMLNEGEEQSDHLFLTTGK
IGLFKEIASKWFGQPIENVKHIHLEKE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagagcaatcggtgttatcgattcaggagttggcggcttaacagtagcgaaggaa
ttaattcgtcagttgccgaaagagcgcattatttatttaggggatacagcacgttgccct
tatggtccacgttctcgagaagaagtgcgccaattcacgtgggagatgacggagcattta
ctagatttaaatatcaaaatgttagttattgcatgcaatacagcaactgcagttgtatta
gaagagatgcagaaacaattaccaattccagtggtaggagttattcacccaggatcacgt
acagctttaaaagtgacaaacacataccatgttgggattattggaacgattggaacggtg
aaaagtggtgcatacgaagaggcgttaaagtctattaataaccgtgttatggtagaaagt
tttgcgtgtccgcctttcgttgagcttgtagagagtggcaattttgaaagtgaaatggca
tatgaagttgtaagagaaacgttgcaaccgctgaaaaatactgatattgatacacttatt
ttaggttgtacacattatccaattttaggtcctgttattaaacaagtaatgggagataaa
gtacaactcattagttcaggtgatgaaacagcgcgtgaagtaagtacaattttataccat
agtaaaatgttgaatgagggagaggaacaaagcgaccatctcttcttaacaacagggaaa
ataggcttatttaaagaaattgcatcaaaatggttcggtcaaccgattgaaaatgtgaag
catattcatttagaaaaagaataa

DBGET integrated database retrieval system