KEGG   Bacillus cereus biovar anthracis CI: BACI_c45160Help
Entry
BACI_c45160       CDS       T01279                                 

Gene name
phaB2
Definition
(GenBank) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00071  Fatty acid degradation
bal00362  Benzoate degradation
bal01100  Metabolic pathways
bal01120  Microbial metabolism in diverse environments
bal01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BACI_c45160 (phaB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BACI_c45160 (phaB2)
Enzymes [BR:bal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BACI_c45160 (phaB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADK07106
UniProt: D8GXD7
Position
complement(4262499..4263275)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGV
FAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggctacgttaaatcat
gcgccagctaacgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggagaaggatgataatattcgtgttgttgttattcatggtgaagggcgcttcttctcg
gcgggagcagatattaaagaatttacatctgttactgaagcgaagcaagcgactgaatta
gcgcagcttggacaagttacgtttgagcgcgttgaaaaatgttcaaaaccagttatcgcg
gcaattcatggagcggcacttggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagcgcaaaacttggtttacctgaattaacacttggattaattcctgga
tttgcaggtacacagcgattaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccgattactggtgcagaagcattaaaatggggactagttaacggagtt
tttgctgaagaaacatttttagatgatacgcttaaagttgcaaaacagattgctggaaaa
agcccagcgacggcccgtgctgtactagagttattgcaaacgacgaaatcgtctcattat
tatgagggtgtacaacgcgaagctcaaatctttggtgaagtatttacgagtgaagatgga
agagaaggtgtagcagcatttttagaaaagcgtaagccttcatttagtggcaggtag

DBGET integrated database retrieval system