KEGG   Bacillus cereus biovar anthracis CI: BACI_c49440Help
Entry
BACI_c49440       CDS       T01279                                 

Gene name
dapF
Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00300  Lysine biosynthesis
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
bal01130  Biosynthesis of antibiotics
bal01230  Biosynthesis of amino acids
Module
bal_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BACI_c49440 (dapF)
Enzymes [BR:bal01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     BACI_c49440 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase PhzC-PhzF Pro_racemase
Motif
Other DBs
NCBI-ProteinID: ADK07499
UniProt: D8H0N1
Position
complement(4651656..4652522)
Genome map
AA seq 288 aa AA seqDB search
MSQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAP
VKMRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFAIETLAGIVTAEVTVEEGKVTL
AKIDMGAPRLTRAEIPMLGEGETPFIRENFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAP
LTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILN
GKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYKIEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattttcttttacaaaaatgcatggtcttggcaatagttatatatatgtaaat
atgtttgaagaacaaattcctgaagaagatttagctcttgtggcggaaaaggtttcaaat
attaatactggtattggagccgatggaatgattttaatttgtccatctgacgtagcacct
gtgaaaatgcgcatgtttaataatgatggatcagaaggaaagagctgtggtaacggtcta
cgctgcgtagcgaaatatgcgtatgagcataaactagtagaagatacagttttcgcaatt
gaaacgttagctggcattgtaacggcggaagtaacggtagaagaagggaaagttacgtta
gcgaaaatcgatatgggagcacctcgtttaacacgtgcggaaataccgatgcttggtgaa
ggtgaaaccccatttattcgtgaaaacttcttatacaataatcatcgttatgcatttaca
gctgtttcaatgggaaatccgcatgcggttatttttgtggatgatgtagaacaagcacct
cttacaacacttggaccagttcttgagacacatgaaatgttcccagaacgagtaaatgtt
gaatttatcgagattttgaatgaagaagagatgaacttccgcgtttgggaacgtggatct
ggcgtaacacaagcttgcggaacaggggcgtgtgctgcagttgttgcctctattttaaat
gggaagatggaacgtggtaaggaaattacagttcatttagctggcggcgatttaatgatt
gcatggacagaagaaggcaatgtgttaatgaaaggaccagcggaagtaatttgccgcgga
gtgtatgagtacaagatagaagcgtaa

DBGET integrated database retrieval system