KEGG   Bacillus cereus biovar anthracis CI: BACI_pCIXO200610Help
Entry
BACI_pCIXO200610  CDS       T01279                                 

Gene name
capD
Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00430  Taurine and hypotaurine metabolism
bal00460  Cyanoamino acid metabolism
bal00480  Glutathione metabolism
bal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BACI_pCIXO200610 (capD)
   00460 Cyanoamino acid metabolism
    BACI_pCIXO200610 (capD)
   00480 Glutathione metabolism
    BACI_pCIXO200610 (capD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bal01002]
    BACI_pCIXO200610 (capD)
Enzymes [BR:bal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BACI_pCIXO200610 (capD)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BACI_pCIXO200610 (capD)
Peptidases and inhibitors [BR:bal01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BACI_pCIXO200610 (capD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept sCache_like
Motif
Other DBs
NCBI-ProteinID: ADK08305
UniProt: D8HAK3
Position
pCI-XO2:complement(52776..54362)
Genome map
AA seq 528 aa AA seqDB search
MNSFKWGKKIILFCLIVSLMGGIGVSCSFNKIKDSVKQKIDSMGDKGTYGVSASHPLAVE
EGMKVLKNGGSAVDAAIVVSYVLGVVELYASGIGGGGGMLIISKDKETFIDYRETTPYFT
GNQKPHIGVPGFVAGMEYIHDNYGSLPMGELLQPAINYAEKGFKVDDSLTMRLDLAKPRI
YSDKLSIFYPNGEPIETGETLIQTDLARTLKKIQKEGAKGFYEGGVARAISKTAKISLED
IEGYKVEVRKPVKGNYMGYDVYTAPPPFSGVTLLQMLKLAEKKEVYKDVDHTATYMSKME
EISRIAYQDRKKNLGDPNYVNMDPNKMVSDKYISTMKNENGDALSEAEHESTTHFVIIDR
DGTVVSSTNTLSNFFGTGKYTAGFFLNNQLQNFGSEGINSYEPGKRSRTFMAPTVLKKDG
ETIGIGSPGGNRIPQILTPILDKYTHGKGSLQDIINEYRFTFEKNTAYTEIQLSSEVKNE
LSRKGLNVKKKVSPAFFGGVQALIKDERDNVITGAGDDRRNGTWKSNK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
ttgaattcctttaaatggggaaagaagataattcttttctgtttgatagtcagcttaatg
gggggtatcggggtatcctgttctttcaataaaataaaagacagtgttaagcaaaaaatt
gatagtatgggtgataaaggaacttatggagtgagtgcctctcacccccttgcggttgag
gaaggtatgaaagtattaaagaacggtggaagtgcagtagatgcagcgattgtggtctca
tatgttttaggcgttgtagaactgtatgcctcaggaataggtgggggcggtggaatgctc
attatatctaaagataaagaaacctttattgattatcgtgaaacaactccgtactttaca
ggaaaccaaaagccacatattggagtacccggatttgtggctggaatggagtatattcat
gataattatggttcattaccgatgggtgagttattacaaccagccattaattatgcggaa
aaagggttcaaggtagatgattccttaacaatgcgattagaccttgcgaagccacgtatt
tattctgataagctaagtatcttctatccgaatggtgaacctattgaaactggagaaaca
cttatccagacagatttagcgagaaccttaaagaagattcaaaaagaaggggctaaaggc
ttttatgaaggaggagtcgctagggcaatcagtaaaactgcaaaaatatcgttagaagat
atagaaggatataaagtagaggtacgtaaaccagtaaaaggtaactacatgggatatgat
gtttataccgctccaccacctttttcaggagttactttattacaaatgttgaaattagct
gaaaagaaagaagtatataaagatgtagatcatacggcaacttatatgtctaaaatggaa
gagatttcaaggattgcctatcaagatagaaagaaaaacctaggggatccaaattacgtt
aatatggatccaaataaaatggtgagtgacaaatatatatcaacaatgaagaatgagaat
ggtgatgcgctttcggaagcagagcatgaaagcacaacgcattttgttatcattgataga
gatggaacggttgtctcttcaactaatacactaagcaatttctttggaacaggaaagtac
acagcagggttcttcttaaataatcaattgcagaactttggaagtgagggaattaatagt
tatgaacctggtaaacgttcacgaacgtttatggcccccactgtattaaagaaagatggg
gaaacgatcggcattgggtcaccaggtggtaaccgtattccgcaaattttaaccccaata
ttggataaatatacgcatggtaagggtagcttgcaagacattatcaatgaataccgtttt
acttttgaaaaaaatacagcgtatacagagattcagctaagttcagaagtgaaaaatgag
ttatctagaaaaggattgaacgtaaagaagaaagtatcccctgccttttttggtggggta
caggccttaattaaagacgagagagataatgttatcaccggcgctggagatgacagaaga
aatggaacttggaaatcaaataaatag

DBGET integrated database retrieval system