KEGG   Bacillus sp. LM 4-2: BsLM_1078Help
Entry
BsLM_1078         CDS       T03908                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
balm  Bacillus sp. LM 4-2
Pathway
balm00071  Fatty acid degradation
balm00072  Synthesis and degradation of ketone bodies
balm00280  Valine, leucine and isoleucine degradation
balm00310  Lysine degradation
balm00362  Benzoate degradation
balm00380  Tryptophan metabolism
balm00620  Pyruvate metabolism
balm00630  Glyoxylate and dicarboxylate metabolism
balm00640  Propanoate metabolism
balm00650  Butanoate metabolism
balm00900  Terpenoid backbone biosynthesis
balm01100  Metabolic pathways
balm01110  Biosynthesis of secondary metabolites
balm01120  Microbial metabolism in diverse environments
balm01130  Biosynthesis of antibiotics
balm01200  Carbon metabolism
balm01212  Fatty acid metabolism
balm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:balm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BsLM_1078
   00630 Glyoxylate and dicarboxylate metabolism
    BsLM_1078
   00640 Propanoate metabolism
    BsLM_1078
   00650 Butanoate metabolism
    BsLM_1078
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BsLM_1078
   00072 Synthesis and degradation of ketone bodies
    BsLM_1078
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BsLM_1078
   00310 Lysine degradation
    BsLM_1078
   00380 Tryptophan metabolism
    BsLM_1078
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BsLM_1078
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BsLM_1078
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BsLM_1078
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:balm04147]
    BsLM_1078
Enzymes [BR:balm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BsLM_1078
Exosome [BR:balm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BsLM_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKE22877
UniProt: A0A125UFW0
Position
complement(1086403..1087497)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGNQNGLLKPFLPEDLSAPIIRCLSQKLEDQVDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQVGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQRSRNAHDEGFYREEIVALGE
LEMDEAFLKTRPIEAIIPRAKPVFDTSSGTVTAANSSGIADGAAALLVMEEEKAVALGLK
PVLRFIGSAVSGIHPNYPPAAPVDAIRNLLHTHDVTPEDIGLFEINEAFAVKICVCSQEL
GIPLSKINVRGGALALGHPYGASGAALVTRLFYEAKRRTDCQYAVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggttattgttgatgcaaaacgaacgatctttggaaatcaaaacggactgctg
aagcccttcctgccggaggatttgtcagctcccatcatccgctgtctcagccaaaagcta
gaggatcaagttgacgaggtcattctcggaaacgctaccggcagaggcggcaacctcgcc
agactgtcagcccttcaagccggactgcctttatcggttcccggaatgacaattgacaga
cagtgcggctcaggccttgaagctgtgcgctatgcctgcagccttattcaagtgggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gcccgcttttctccagatgccatcggcgatccagacatgggcattgcggcagaatatacg
gctgcacgctattccatcagcagaagcatgcaggatgagtacgcgcttctcagccatcaa
cgcagcaggaacgcgcatgatgaaggattttaccgtgaagaaattgttgctcttggggaa
ttggagatggacgaagcatttttgaaaacgcggccaatagaagcgattattccccgtgca
aagccggttttcgacaccagctccggaacagtcacagcagccaacagcagcggcatagca
gacggagcagcggctcttttggtaatggaagaagaaaaagcggtagccctcggacttaag
cctgtgcttcggtttatcggcagcgctgtcagcggcattcaccccaactatccgcccgcg
gcaccggttgatgcgatccgtaacctcttacatacacacgatgtaacacctgaggatatc
ggtttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccctttcaaaaatcaatgtgcgcggcggcgcattagcgcttggccatccatac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggacagac
tgtcaatatgctgttgcagccatcggaagcggcggcggaatcggactggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system