KEGG   Bacillus sp. LM 4-2: BsLM_3830Help
Entry
BsLM_3830         CDS       T03908                                 

Definition
(GenBank) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
balm  Bacillus sp. LM 4-2
Pathway
balm00010  Glycolysis / Gluconeogenesis
balm00053  Ascorbate and aldarate metabolism
balm00071  Fatty acid degradation
balm00280  Valine, leucine and isoleucine degradation
balm00310  Lysine degradation
balm00330  Arginine and proline metabolism
balm00340  Histidine metabolism
balm00380  Tryptophan metabolism
balm00410  beta-Alanine metabolism
balm00561  Glycerolipid metabolism
balm00620  Pyruvate metabolism
balm00625  Chloroalkane and chloroalkene degradation
balm01100  Metabolic pathways
balm01110  Biosynthesis of secondary metabolites
balm01120  Microbial metabolism in diverse environments
balm01130  Biosynthesis of antibiotics
Module
balm_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:balm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BsLM_3830
   00053 Ascorbate and aldarate metabolism
    BsLM_3830
   00620 Pyruvate metabolism
    BsLM_3830
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BsLM_3830
   00561 Glycerolipid metabolism
    BsLM_3830
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BsLM_3830
   00310 Lysine degradation
    BsLM_3830
   00330 Arginine and proline metabolism
    BsLM_3830
   00340 Histidine metabolism
    BsLM_3830
   00380 Tryptophan metabolism
    BsLM_3830
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BsLM_3830
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BsLM_3830
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BsLM_3830
Enzymes [BR:balm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BsLM_3830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKE25627
Position
3750044..3751414
Genome map
AA seq 456 aa AA seqDB search
MNSIPSIISKHKAYFAAGHTRPLESRLNILRKLKQAVRTHEADLIAALYQDLHKSEQEAY
STEIGIVLEEISFVMKRLKKWSKPKRVKTPLTHLGSKSIIIPEPYGTVLVIAPWNYPLQL
ALSPLIGAIAAGNTVVLKPSEYTPAVSAALSELISSVFPTDYVAMAEGGPDVSTALLQQP
FDYIFFTGSVAVGKVVMEAAAKQLIPVTLELGGKSPCIVHKDADIQLAAKRIVFGKFTNA
GQTCIAPDYLFVHEDIKTKLAEEMKRAIREFYGPQPERNPQYGKIVSERHYQRLLSFLND
GIPLTGGQSDPNHHKIAPTILEQVRDDSPVMQEEIFGPILPLFTYRNIGEVIEKIQSRPK
PLALYLFTTNKETERAVLGNLSFGGGCVNDTLMHVATPYLPFGGVGESGIGSYHGFDSFN
TFTHKKSVVKQTNRFDFAFRYPSSKNGLRMIRKILK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcatcccctctatcatcagcaagcataaagcctattttgcggcgggacatacg
agaccgcttgaatcgagactgaacattttgcgaaagctgaaacaagccgtcagaactcat
gaagccgatcttatagccgctctctaccaggatctccacaaatccgagcaagaagcatac
tcaacagaaatcggaatcgtcttggaggaaatcagctttgtcatgaaacggctgaaaaaa
tggtccaagccgaaacgagtcaaaacgccgctgactcatctaggctccaaaagcatcatc
attcctgagccgtatggaaccgttttggtgattgcaccttggaactatcccttgcagctg
gcgctttctccgttgattggagccattgcggcggggaacacggtcgttctcaagccatcg
gaatatacgccggctgtttctgctgcactttcggaactcatcagcagcgtttttccgacc
gattatgtcgctatggcagaaggcgggcccgacgtcagcacagcattattacagcagccc
tttgactacattttctttacaggcagcgtagccgtgggaaaagtcgtcatggaggccgcc
gccaaacaattaattcccgtaaccttggagctcggcggcaaaagcccctgcatcgtccat
aaagatgctgacattcagcttgccgccaaacgcatcgtcttcgggaaatttacaaatgcg
ggacaaacctgcatcgcaccggattatttatttgtccacgaggacatcaaaacgaagctg
gcagaagaaatgaagcgtgcgatcagagaattttacggccctcagccggaacggaatccg
cagtacggcaaaatcgtcagtgaacggcactatcagcggctgctcagctttctgaatgac
ggcatcccactcacaggcggacaatctgatcccaatcatcacaaaattgcgccgaccatt
ctcgaacaagtgagggatgactctccagtgatgcaggaggagattttcgggccgattctt
ccgctctttacataccgcaatatcggggaagtcattgaaaaaatccaatcgcgccctaag
ccactcgccctgtatctcttcaccacaaacaaagaaactgagcgcgctgttttaggaaat
ctgtcgtttggcgggggctgtgtcaatgatacgttaatgcatgtggcgacgccgtatttg
ccattcggcggcgtcggggaaagcggcatcggcagctatcacggctttgacagttttaac
acattcacgcacaaaaaaagcgtcgtcaaacaaacgaaccgcttcgacttcgcatttcgt
tatccttcctccaaaaacgggctgcggatgattcgaaaaatactcaaataa

DBGET integrated database retrieval system