KEGG   Bacillus altitudinis: CFN77_04665Help
Entry
CFN77_04665       CDS       T05199                                 

Definition
(GenBank) RluA family pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
balt  Bacillus altitudinis
Brite
KEGG Orthology (KO) [BR:balt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:balt03009]
    CFN77_04665
Enzymes [BR:balt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CFN77_04665
Ribosome biogenesis [BR:balt03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CFN77_04665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ATH71503
Position
complement(926113..927015)
Genome map
AA seq 300 aa AA seqDB search
MIIKGHMLSLKVGEQQNGISLSQFLKDEVSASKPIIHFWMEHQKVRLNQKPAHHAAKVST
GDQILIDLFETEESDVTPEYGELEVLFEDEHLLVVQKPAGKPTHPNEKGQTGTLANLVAF
HFQANGEEKRVRHIHRLDQDTSGTVIFAKHRLAHAVLDQMLSKKAINRTYLAIAQGLFKK
KKGTIQAAIGRDKHHAVRRRVSPTGQSAKTHYEVFHLNKRLQMTAVKLQLETGRTHQIRV
HLSSLGHPLAGDTLYGGKRDLINRCALHAKQVDMNHPFTGEKLTIEAPLPPDMAELMDNM
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgatcataaaaggacacatgctctccctaaaagtaggtgagcagcaaaatggcatttcc
ttaagtcaatttttaaaagacgaagtgtctgcctctaaaccaattatccatttttggatg
gagcaccaaaaagtccgtctcaatcaaaaacctgcccaccatgctgcaaaagtgagtaca
ggtgatcagattctcattgatttatttgagacggaagaaagtgatgtgacgccagaatac
ggtgaattagaggtactctttgaagacgagcatttattagttgtccaaaagcctgctgga
aagccgacgcatccaaatgaaaaaggacaaacaggtacgctggcgaacctagtcgctttc
cattttcaagcaaatggagaagaaaagcgggtcagacatatacataggctggatcaagac
acaagcggcaccgttatttttgccaaacacaggttggcacatgctgtactcgatcaaatg
ctttcaaaaaaagcgattaacagaacgtatcttgccatcgcacaaggactgtttaagaaa
aagaaaggaacgatccaagcagccattggacgtgataaacaccatgccgtcagaaggagg
gtttctcctactggtcaaagcgccaagactcattatgaggtcttccatctcaataaacgt
ttacagatgacggccgttaagctgcaattagaaacaggcagaacgcatcaaattcgggtc
catcttagcagtctcgggcatcctttagctggcgatacattatatggcgggaagcgtgac
ctgataaacagatgcgctcttcatgccaaacaagtagacatgaaccatccattcacaggt
gaaaagctgacgatagaagcaccgcttccacctgatatggctgaattaatggacaatatg
tag

DBGET integrated database retrieval system