KEGG   Bacillus altitudinis: CFN77_15540Help
Entry
CFN77_15540       CDS       T05199                                 

Definition
(GenBank) TIGR01457 family HAD-type hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
balt  Bacillus altitudinis
Pathway
balt00627  Aminobenzoate degradation
balt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:balt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CFN77_15540
Enzymes [BR:balt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     CFN77_15540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: ATH73557
Position
complement(2968593..2969363)
Genome map
AA seq 256 aa AA seqDB search
MKYKGYLIDLDGTMYKGTEKIEEAGQFVHKLNELNIPYLFVTNNSSRTPKQVAEKLVSFD
IPATEEQVFTTSMATANYIAEQKRDASVYVIGEEGIQQAIEEKGLSFGQEDADFVVVGID
RGITYEKLAVGAIAIRQGAQFVSTNGDIAIPTERGLLPGNGSLTSVLTVTTTVEPTFIGK
PESIIMEQAMRVLGTDVSETLMVGDNYDTDIMAGMNAGMDTLLVHTGVTTKELLQKYDKQ
PTYVTDSLSEWIERLS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaggctatttaattgatttagacgggacgatgtataaaggaacagaaaag
attgaagaggcggggcaatttgttcacaagttaaatgagttgaacatcccttatttgttt
gtcacgaataactcttcacgcacgccgaagcaagtagcagaaaaactggtttcattcgat
attccagcaacggaagaacaagtctttacaacaagtatggcgacggcaaactatatcgca
gaacaaaagagagatgcctcggtgtatgtgataggagaagaaggaattcagcaggccatc
gaagaaaaaggcttgtcgtttggtcaagaagacgctgatttcgttgtcgttggaatagac
cgcggtattacatatgaaaaactagcggtaggagccattgcgatccgtcaaggtgcacaa
tttgtttcaacaaatggagatattgccattccgacagaaagagggctgttacctggaaat
ggatcgttaacatctgtgctgacggttacgacaacagtggagccaacatttatcgggaag
ccagagtctatcattatggaacaggccatgcgggtgctcgggacagatgtgtcagagacg
ctcatggtgggcgataactatgataccgatattatggcagggatgaatgcagggatggat
acactgcttgtccatacaggcgtcacgacaaaagagctgcttcagaaatatgacaaacag
ccaacctatgtcactgattcattatctgagtggattgaacgattatcttaa

DBGET integrated database retrieval system