KEGG   Bacillus altitudinis: CFN77_17820Help
Entry
CFN77_17820       CDS       T05199                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
balt  Bacillus altitudinis
Pathway
balt00071  Fatty acid degradation
balt00072  Synthesis and degradation of ketone bodies
balt00280  Valine, leucine and isoleucine degradation
balt00310  Lysine degradation
balt00362  Benzoate degradation
balt00380  Tryptophan metabolism
balt00620  Pyruvate metabolism
balt00630  Glyoxylate and dicarboxylate metabolism
balt00640  Propanoate metabolism
balt00650  Butanoate metabolism
balt00900  Terpenoid backbone biosynthesis
balt01100  Metabolic pathways
balt01110  Biosynthesis of secondary metabolites
balt01120  Microbial metabolism in diverse environments
balt01130  Biosynthesis of antibiotics
balt01200  Carbon metabolism
balt01212  Fatty acid metabolism
balt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:balt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFN77_17820
   00630 Glyoxylate and dicarboxylate metabolism
    CFN77_17820
   00640 Propanoate metabolism
    CFN77_17820
   00650 Butanoate metabolism
    CFN77_17820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFN77_17820
   00072 Synthesis and degradation of ketone bodies
    CFN77_17820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFN77_17820
   00310 Lysine degradation
    CFN77_17820
   00380 Tryptophan metabolism
    CFN77_17820
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFN77_17820
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFN77_17820
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFN77_17820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:balt04147]
    CFN77_17820
Enzymes [BR:balt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFN77_17820
Exosome [BR:balt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFN77_17820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ATH73994
Position
complement(3424738..3425913)
Genome map
AA seq 391 aa AA seqDB search
MSTTVIVSGARTPFGKLGGTLSRLTAAELGGMTIKAALERASNVHEVDEVIMGSVLQGGQ
GQIPSRQAARHADLPWSVPTQTINKVCASGMRSVTTADQIIRAGDANVIVAGGMESMSHA
PYLLKKARWGYKMGDGAVQDAMILDGLTCSFTGVHMGEYGSMAAKELGITREEQDLWALR
SHERAIEAQKSGFFKNEIIPVTVKNQKGDQLISEDEAPRRDTSYERLSKLMPVFDQAGTI
TAGNAPGVNDGASALLLMKDTYAMQQGEKPLAVVLGHAQVAVEAKDFPKTPAYAIEKVLK
KTGKQVEDIDLFEINEAFSAVALACEKILGLDRRKMNVNGGAVAIGHPIGASGTRIILTL
IHALRQRGGGIGIAAICSGGGQGDAIMIKVD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgacggtcattgtatctggggcgagaacaccatttggaaaactaggtggaact
ttaagtcgtttgactgctgcagaattaggcgggatgacgataaaagctgcgctggaaaga
gcctcaaatgttcatgaagtggatgaagtcatcatgggcagtgtccttcaagggggacaa
ggtcaaattccttcaagacaggcagctagacatgcagatctcccttggtcggttccgacg
caaaccatcaacaaagtctgtgcttcaggaatgcgcagtgtcacgacagccgatcaaatc
attcgagcgggagatgccaatgtgatcgtggcaggcggcatggaatccatgtctcatgct
ccttatcttctaaaaaaagcacgatggggttacaaaatgggagatggtgctgtacaagat
gccatgattttagatggattaacctgttcgtttacaggtgttcatatgggtgagtatgga
agcatggcggcgaaagagcttggcattacacgagaagaacaagacctttgggcgttaaga
agtcatgaacgagccattgaggcgcaaaaaagcggcttttttaaaaatgagatcatcccc
gttaccgtcaagaatcaaaaaggagatcagctgatttcagaagatgaagccccgcggcgt
gatacgtcatatgaacgtttgtcaaaactgatgcccgttttcgatcaggcaggtacgatc
actgctggcaatgcaccgggtgtcaatgatggtgcaagtgcgcttctattaatgaaagac
acatacgccatgcagcaaggtgaaaaacctctggcagttgtgcttgggcatgcgcaagta
gcagtagaggcaaaggactttccgaaaacaccagcttatgccatcgaaaaagtgttaaag
aaaacagggaagcaagtagaggatatcgatttgtttgaaatcaatgaggctttttcagcg
gttgcattggcatgcgaaaaaattcttggactggatcggcggaaaatgaatgtgaacgga
ggggcagtcgcgattggtcacccgattggagcaagcggaacacgtattatattgaccttg
atccatgcactcagacaaagaggcggcgggatcggcattgcggcgatttgcagcggcggg
ggtcaaggtgatgcgatcatgatcaaggtggattaa

DBGET integrated database retrieval system