KEGG   Burkholderia ambifaria AMMD: Bamb_0436Help
Entry
Bamb_0436         CDS       T00398                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01130  Biosynthesis of antibiotics
bam01230  Biosynthesis of amino acids
Module
bam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bamb_0436
Enzymes [BR:bam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bamb_0436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABI85995
UniProt: Q0BIM8
Position
1:complement(487646..488431)
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKREEIAAAMRSAPLEALKLEASARDLRDFVGALRAKQAAGHAAVIAEVK
KASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGSVRYLEEARAACTLPVLRK
DFIVDAYQILEARAMGADAILLIAAALDTPLMQDLEAYAHSLGLAVLVEVHDRDEMEQAL
TLKTPLLGINNRNLRTFETSIQTTLDMLDMIPPERIVVTESGILSRTDVDTMRAANVNAF
LVGEAFMRADQPGEELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgaatcatcgccgtcaagcgcgaagaaatcgcggcggccatg
cgcagcgcgccgctcgaggcactgaagctggaagcatcggcgcgtgacctgcgcgacttc
gtcggcgcactgcgcgcgaagcaggcggccggccacgcggcggtgatcgccgaagtgaag
aaggcgagcccgtcgaagggcgtgctgcgcgagcatttcgtgccggccgacatcgcgcgc
tcgtatgcggcacatggcgccgcgtgcctgtcggtgctgaccgacgagcagttcttccag
ggcagcgtccgctacctcgaggaagcgcgcgcggcctgcacgctgccggtgctgcgcaag
gacttcatcgtcgacgcgtaccagatcctcgaagcacgcgcgatgggcgccgacgcgatc
ctgctgatcgcggccgcgctcgacacgccgctgatgcaggatctcgaggcgtatgcgcac
tcgctcggcctcgcggtgctggtcgaagtccacgaccgcgacgagatggaacaggcgctg
acgctgaagacaccgctgctcggcatcaacaaccgcaacctgcgcacgttcgagacgtcg
atccagaccacgctcgacatgctcgacatgattccgccggaacgcatcgtcgtgaccgag
tctgggatcctgtcgcgcaccgacgtcgacacgatgcgcgcggcgaacgtgaacgcgttc
ctcgtcggcgaagcgttcatgcgcgccgaccagccgggcgaggaactcgcgcggatgttc
ttctga

DBGET integrated database retrieval system