KEGG   Burkholderia ambifaria AMMD: Bamb_0442Help
Entry
Bamb_0442         CDS       T00398                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
bam  Burkholderia ambifaria AMMD
Brite
KEGG Orthology (KO) [BR:bam00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Bamb_0442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: ABI86001
UniProt: Q0BIM2
Position
1:493595..493969
Genome map
AA seq 124 aa AA seqDB search
MSQYQFTVSVKTSYLPEQSDPDRRQYAFAYTLTIRNTGQVAAQLIARHWIITDSENHVQE
VKGLGVVGHQPLLQPGEHFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVEEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtatcagttcaccgtttcggtgaaaaccagctacctgccggaacaatccgac
cccgatcgacgtcaatacgcattcgcgtacacgctgaccatccgcaataccgggcaggtc
gcggcgcagctgatcgcgcgtcactggatcatcacggacagcgagaaccacgtgcaggaa
gtgaaggggctcggcgtcgtcgggcaccagccgctgctgcagccgggcgaacacttcgaa
tacacgagctgggcagtgatcgcgacgccggtcggcacgatgcgcggcgcgtacttctgc
gtggcggaggacggcgagcggttcgaggcgccggtcgaggaatttgcgctgcacatgccg
cgcacgctgcattga

DBGET integrated database retrieval system