KEGG   Burkholderia ambifaria AMMD: Bamb_0487Help
Entry
Bamb_0487         CDS       T00398                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00330  Arginine and proline metabolism
bam00332  Carbapenem biosynthesis
bam01100  Metabolic pathways
bam01130  Biosynthesis of antibiotics
bam01230  Biosynthesis of amino acids
Module
bam_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bamb_0487
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Bamb_0487
Enzymes [BR:bam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Bamb_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABI86046
UniProt: Q0BIH7
Position
1:550744..551862
Genome map
AA seq 372 aa AA seqDB search
MRSIIADSKRLVVKVGSSLVTNDGKGLDHAAIGRWAAQIAALRAQGKEVVLVSSGAIAEG
MQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFTEHDIRTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQSGLFT
ADPRKDPNATLVAEASAGAPDLEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
RETDVLVRLAAGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDAGAVEKLTAGGKSL
LPIGVIGVQGAFARGEVIACVGPDGREVARGLTNYSSAETKLIHRKPSGEIETVLGYMLE
PELIHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgatcatcgcggattcgaagcgattggtggtgaaggtgggctcgagcctcgtg
accaacgacggcaaggggctcgatcatgctgcaatcggccgctgggcggcccagatcgcc
gcgctgcgcgcgcagggcaaggaagtggtgctcgtcagttcgggtgcgattgccgaaggg
atgcagcggctcggctggagcaagcgtccgcgcgagatcgacgagctgcaggctgccgcc
gcggtcggccagatggggctcgcgcaagtctatgaaagccgctttaccgagcacgacatc
cgcaccgcgcagatcctgctcacgcacgccgacctcgcagatcgcgaacgctacctgaat
gcacgctcgacgctgctcacgctgctgcggctcggcgtcgtgccgatcatcaacgagaac
gacacggtcgtcaccgacgaaatcaagttcggcgacaacgacacgctcggcgcactcgtc
gcgaacctgatcgaaggcgacgcactgatcatcctgaccgaccagtcggggctgttcacc
gccgatccgcgcaaggatccgaacgcgacgctcgtcgcggaagccagcgcgggcgcgccg
gacctcgaggcgatggcgggtggcgcaggctcgagcctcggccgcggcgggatgctgacg
aagatcctcgcggcgaagcgcgcggcgcacagcggcgcgaacaccgtgattgcgagcggc
cgcgaaaccgacgtgctggtgcggctcgcggccggtgaggcgatcggcacgcagctgatc
gcgcgcaccgcgcggatggccgcgcgcaagcaatggatggccgatcacctgcaggtgcgc
gggcacgtcgtgatcgatgcgggcgcggtcgagaagctgacggccggcggcaagagcctg
ctgccgatcggcgtgatcggcgtgcagggtgcgttcgcgcgcggcgaggtcattgcctgc
gttggccccgacgggcgtgaagtggcgcgcggcctcacgaactacagcagcgcggaaacg
aagctgattcatcgcaagccgagcggcgagatcgagactgtgctcggctacatgctggag
ccggagctgattcaccgcgacaacctcgtgctggtgtaa

DBGET integrated database retrieval system