KEGG   Burkholderia ambifaria AMMD: Bamb_0575
Entry
Bamb_0575         CDS       T00398                                 

Definition
(GenBank) iron-sulfur cluster assembly accessory protein
  KO
K15724  iron-sulfur cluster insertion protein
Organism
bam  Burkholderia ambifaria AMMD
Brite
KEGG Orthology (KO) [BR:bam00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Bamb_0575
SSDB
Motif
Pfam: Fe-S_biosyn
Other DBs
NCBI-ProteinID: ABI86134
UniProt: Q0BI89
Position
1:647664..648035
AA seq 123 aa
MNAVTESAATTAEMPVPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTF
DEEVNEDDTVMNKNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSS
FSV
NT seq 372 nt   +upstreamnt  +downstreamnt
atgaacgctgttaccgaatccgcagcaacgacggccgaaatgccggtaccgttcgtcttc
accgacgccgcggccgacaaggtcaagcaactgatcgacgaagagggcaatcccgacctg
aagctgcgcgtgttcgtgcagggtggcggctgctcgggcttccagtatggcttcacgttc
gacgaggaagtcaacgaggacgacaccgtgatgaacaagaacggcgtccagctcctgatc
gattcgatgagctaccagtacctggtcggcgccgagatcgactacaaggacgacctcaat
ggcgcccagttcgtgatcaagaacccgaacgccacgaccacctgcgggtgcggctcgtcg
ttctcggtctga

DBGET integrated database retrieval system