KEGG   Burkholderia ambifaria AMMD: Bamb_0929Help
Entry
Bamb_0929         CDS       T00398                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase precursor
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00540  Lipopolysaccharide biosynthesis
bam01100  Metabolic pathways
Module
bam_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Bamb_0929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bam01005]
    Bamb_0929
Enzymes [BR:bam01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Bamb_0929
Lipopolysaccharide biosynthesis proteins [BR:bam01005]
 Unusual sugar
  Bamb_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 NAD_binding_10 KR adh_short DapB_N
Motif
Other DBs
NCBI-ProteinID: ABI86488
UniProt: Q0BH85
Position
1:1021853..1022845
Genome map
AA seq 330 aa AA seqDB search
MTVIVTGAAGFIGANIVKALNERGESRIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVER
FTRGDFGKVRAVFHEGACSDTMETDGRYMMDNNFRYSRAVLDACLAQGAQFLYASSAAIY
GGSTRFVEEREVEAPLNVYGYSKFLFDQVIRRVLPSAKSQIAGFRYFNVYGPRETHKGRM
ASVAFHNFNQFRAEGKVKLFGEYNGYAPGEQTRDFVSVEDVAKVNLFFFDHPEKSGIFNL
GTGRAQPFNDIASTVVNTLRALDNLPPLTLAQQVEQGLIEYVAFPDALRGKYQCFTQADQ
TKLRSAGYDAPFLTVQEGVDRYVRWLSGQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcatcgtcaccggcgcagccggttttatcggcgcgaacatcgtcaaggcgctc
aacgagcgcggcgagtcgcgcatcatcgcggtcgacaatctgacgcgcgcggacaagttc
cgcaacctcgtcgattgcgagatcgacgactatctcgacaagacggaattcgtcgaacgc
ttcacgcgcggcgatttcggcaaggtacgcgcggtgttccacgaaggcgcctgttcggac
acgatggaaaccgacggccgctacatgatggacaacaacttccgctacagccgcgcggtg
ctcgatgcgtgcctcgcgcagggcgcgcagttcctgtacgcgtcgtcggccgcgatctac
ggcggctcgacgcggttcgtcgaggagcgcgaggtcgaggcgccgctgaacgtctacggc
tattcgaagttcctgttcgaccaggtgatccgccgcgtgctgccgagcgcgaagagccag
atcgccgggtttcgctacttcaacgtgtacggcccgcgcgagacgcacaagggccgcatg
gcatcggtcgcgttccacaacttcaaccagttccgcgcggaaggcaaggtcaagctgttc
ggcgagtacaacggttatgcgccgggcgagcagacgcgcgatttcgtgtcggtcgaggac
gtcgcgaaagtgaacctgttcttcttcgatcatccggagaagtcgggcatcttcaacctc
ggcaccggccgtgcgcagccgttcaacgacatcgcatcgacggtcgtgaacacgttgcgc
gcgctcgacaacctgccgccgctgacgctcgcgcagcaggtcgagcaagggctgatcgaa
tacgtggcgttccccgacgcgctgcgcggcaagtaccagtgcttcacgcaggccgaccag
acgaagctgcgcagtgccggctacgatgcgccgttcctgacggtgcaggaaggtgtcgac
cgctacgtgcgttggctgtccggccaggtttaa

DBGET integrated database retrieval system