KEGG   Burkholderia ambifaria AMMD: Bamb_1056Help
Entry
Bamb_1056         CDS       T00398                                 

Definition
(GenBank) amino acid ABC transporter ATP-binding protein, PAAT family
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bamb_1056
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bam02000]
    Bamb_1056
Enzymes [BR:bam01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     Bamb_1056
Transporters [BR:bam02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    Bamb_1056
   Histidine transporter
    Bamb_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_15 AAA_16 DUF87 AAA_23 APS_kinase AAA_33 FtsK_SpoIIIE PRK G-alpha AAA_22 AAA_28 NACHT RYDR_ITPR AAA_24 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABI86615
UniProt: Q0BGV8
Position
1:1147587..1148387
Genome map
AA seq 266 aa AA seqDB search
MAEITQTSASASTKLAAVDIHKRYGDNEVLKGVSLNAKAGDVISIIGASGSGKSTFLRCI
NFLERPNAGQIVVDGETVRTKPDRAGALEVADHKQLQRIRTKLAMVFQHFNLWAHMNVLE
NVMEAPVHVLGISKREAEERARAYLEKVGLAPRVEKQYPSHLSGGQQQRVAIARALAMHP
DVMLFDEPTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRTE
EEGDPKEVLVRPQSERLKQFLSGSLK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttggccgagatcactcaaacgagcgcgtccgcttccaccaagcttgccgcggtcgacatt
cacaagcgctacggcgataacgaggtgctcaagggcgtatcgctgaacgcgaaggccggc
gacgtcatcagcatcatcggcgcgagcggttcgggcaagagcacgttcctgcgctgcatc
aattttctcgagcggccgaatgcggggcagatcgtcgtcgacggcgagaccgtgcgcacg
aagcccgaccgcgccggcgcgctcgaggttgccgatcacaagcagttgcagcgcatccgc
acgaagctcgcgatggtgttccagcacttcaatctgtgggcgcacatgaacgtgctcgag
aacgtgatggaagcgccggtgcacgtgctcggcatttcgaagcgggaagccgaggagcgt
gcacgtgcgtacctggagaaggtcggtctcgcgccgcgtgtcgagaagcagtatccgtcg
catctgtcgggcggccagcagcagcgtgtcgcgatcgcgcgtgcgcttgcgatgcatccg
gacgtgatgctgttcgacgagccgacgtcggcgctcgatccggagctcgtcggtgaagtg
ctgaaggtgatgcagaagctggccgaggaaggccgcacgatgatcgtcgtcacgcacgag
atgggttttgcgcgcaacgtgtcgaaccacgtgatgttcctgcatcaggggcggaccgag
gaagagggcgatccgaaggaggtgctggtgcgtccgcagagcgagcgtctgaagcagttc
ctgtcgggcagcctcaagtaa

DBGET integrated database retrieval system