KEGG   Burkholderia ambifaria AMMD: Bamb_2002
Entry
Bamb_2002         CDS       T00398                                 
Name
(GenBank) TRAG family protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bamb_2002
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_2002
Enzymes [BR:bam01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Bamb_2002
Secretion system [BR:bam02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Bamb_2002
SSDB
Motif
Pfam: T4SS-DNA_transf TrwB_AAD_bind TraG-D_C
Other DBs
NCBI-ProteinID: ABI87558
UniProt: Q0BE65
Position
1:2198164..2200161
AA seq 665 aa
MQAQGVLFGQIAVVFSIVIAGVWSATQWTAAALAYQLRLGSPWFDFFGMPVYHPWRLFEW
WFFFDAYAPHVFDIGGAIAGGSGLVAVVVAIAMSVWRSRQSRLVTTYGSARWANTADIRK
AGLMQPAGVLLGLHDGQYLRHEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKG
ENWQITAGWRSRFSHCLLFNPTDAKSAAYNPLLEVRRGAHEVRDVQNIADILVDPEGALE
KRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPACPFELTLHRMMTTKHLGDAP
HTVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIADLIASESPVS
LYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGRDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLG
TATELRAQRNYAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDESVVMVSSVAPIKA
KKLRYYADTNFKQRVLPPPALAAGRYADVPPTRADDWSGLAIPAVPAASATASADDLGGT
DDGGPRRQPELSESVAYDPELDPPDDLALLDDDDDLPLPLPGQLDLAMQRTARLASLDPN
DGIDL
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgcaagctcagggcgtgttgttcgggcagatcgcggttgttttcagcatcgtgatcgcc
ggtgtgtggagtgcaacgcaatggacagccgccgctctggcctaccaactacgccttggc
tcgccctggttcgatttcttcggaatgccggtctatcacccctggcggctgttcgagtgg
tggttcttcttcgatgcctacgcgccgcacgtcttcgatataggcggcgccattgcgggc
ggcagcggcctggtggccgtggtggtcgccatcgccatgtcggtgtggcgctcgcggcaa
tcgcgcctggtcacgacctatggctcagcacgttgggccaacaccgccgacattcgcaaa
gccgggttgatgcagcctgccggcgtccttctcggcctccatgacggacagtacctgcgc
catgaaggcccggaacacgtcctgaccttcgcgcccacgcgctctggcaaaggcgtgggc
ctggtggtgccgacgctgctgtcatggcctgcctcggccgtcatccacgacatcaagggc
gagaactggcagatcaccgccggctggcgttcgcgcttctcgcattgcctgctgttcaac
cccaccgatgcgaagtcagccgcgtacaacccgctgctggaggtacggcgaggcgctcat
gaagtgcgcgacgtacagaacatcgcggacatccttgtcgatcccgaaggggcgctggag
aagcgcaatcactgggagaagaccagccatgcgctgctggtcggcgccatcctgcatgtg
ctctacgccggcgaagacaagacgctgcgcggcgtcgccaacttcctctccgatcctgcg
tgcccgttcgagctgacgctgcatcggatgatgacgacgaagcacctgggcgatgcaccg
cacacggttgtcgcgtccgccgcgcgtgaagtgctcaacaagtcggacaacgagcggtcg
ggcgtgctctcgactgcgatgagcttcttgggcttgtaccgcgaccccacggtggccgag
gtcacctcacgctgcgactggcgcatcgccgacctgatcgcgtccgagtcacccgtgtcg
ctgtacctggtggtgccgccttcggacatcagccgcaccaagccgttgatccggctcatc
ttgaaccagatcgggcgacgcctcaccgaatcgctcgatggcagagacggcatcgaacgc
cgccacaagctgttgctgatgctcgatgagtttccggcgctgggccggctcgacttcttc
gagacggcgcttgccttcatggccggctacggcatccgcagcttcctcatcgcacagtcg
ctcaaccagatcgacaaagcctacggccagaaccattcgattctggacaactgccatgtc
cgggtgacgttcgccacgaacgatgaacgcacggccaaacgcatttcagagaccttgggt
acggcgaccgaactgcgcgcgcagcgcaactacgccggccaccggctcgcgccgtggctc
gggcatctcatggtgtcgcggcaggagacggcccgcccgctgctcacccctggcgaagtg
atgcagctcccgcccgatgaatccgtggtgatggtgtccagcgtggcgccgatcaaggcc
aagaagctgcgctactacgccgacaccaatttcaaacagcgggtactaccaccgcctgcg
cttgcggccgggcggtacgccgacgtgccaccgacccgcgccgacgactggagcggcctg
gcgattccggccgtgcccgccgcatcggccacggcatccgccgatgacctgggcggcacc
gatgacggcggtccgcgccgccaacccgaactctccgaatccgtcgcttacgaccccgag
ctggatccgcccgatgacctggcgctgctcgatgacgacgacgacttgccgctgccgctt
cccggccagcttgacctggccatgcagcgcacggcgcggctggcctccctcgaccccaac
gacggaatcgacttatga

DBGET integrated database retrieval system