KEGG   Burkholderia ambifaria AMMD: Bamb_2008
Entry
Bamb_2008         CDS       T00398                                 
Name
(GenBank) putative conjugal transfer TrbJ signal peptide protein
  KO
K20266  type IV secretion system protein TrbJ
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bam00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bamb_2008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bam02044]
    Bamb_2008
Secretion system [BR:bam02044]
 Type IV secretion system
  Trb secretion system protein
   Bamb_2008
SSDB
Motif
Pfam: UCH
Other DBs
NCBI-ProteinID: ABI87564
UniProt: Q0BE59
Position
1:2204798..2205535
AA seq 245 aa
MKIRVLSASLAAALAGSLMLAQPAAALTFVDPVNLVQNTLTAIRTLEQINNQINQLQNEA
QMLMNQARNLANLDFNIVNRLRSTLASTERLIVEAQGLAYDVQSMDATFARLYPEQYAAT
ISGDRMAQDARERWKNTLDGLHTAMRMQAQVSQNLAQDESALADLVSQSQSATGALQAQQ
ATNQLLALQAKQSIQSQQLQITQDRAASLELARQAAATERAREVRRRFLRSGTPYTPQSI
NFYNN
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaagatccgtgtgctttccgcttcgctcgccgccgcgctggccggctcgctgatgctc
gctcagccggcggcggcgctgaccttcgttgatcccgtcaacttggtgcagaacacgctg
accgccatccgcacccttgagcagatcaacaatcagatcaatcagcttcagaacgaagcg
cagatgttgatgaaccaggcgcgcaacttggcgaatctcgatttcaacatcgtcaaccgc
ctgcgctccacgctcgccagcaccgaacgcctgatcgtcgaggcgcagggactggcctac
gacgtgcagagcatggatgccacgttcgcccgtctgtacccggagcagtacgccgcgacc
atcagcggcgaccgcatggcgcaggacgcccgcgaacgctggaagaacacgctcgatggc
ctgcataccgcgatgcggatgcaggcacaggtgtcgcagaacctggcacaagacgaaagc
gcactggccgatctggtcagccagagccagtccgccaccggcgccttgcaggcgcagcag
gcgaccaaccagcttcttgccttgcaggccaagcagtccatccagtcccagcaactccag
atcacgcaagaccgcgcggcctcgctggaactggcgcggcaggcggcggccaccgagcgc
gcccgcgaagtgcggcggcgcttccttcgcagcggcacgccgtacacgccgcagtccatc
aatttctacaacaactga

DBGET integrated database retrieval system